CAZyme Information: CLCR_01063-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_01063-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
932	LGRB01000016|CGC4	101877.53	7.3214

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000016:266837-269826(-)

Full Sequence      

MALATNGDQPALWDESRQLGQLFMMGFDGTSVTDQVRTLIEKYHVGSILLKAQNLKSAEQ
ATQLVLDLQTLAHQAGHPVPLLIALDQENGGVNSLYDEAYIRQFPSAMGLAATGSKKLAK
DIARATAQELNSCGINWILGPVLDVLTNARNQPLGVRSVGDDPQEVSAYGVECVKGYHEG
GVATCGKHFPSYGNLEFFGVPDDVPTITDSIENLSQTALIPFRTAIAHGIDSMMVGGVAM
ASSQVNVMHACLSEQIVRDLLRHELRFDGVVVSECLEMDALSRNIGISGGTVMAFKAGCD
LILTCRTLSVQEDAINGLTAGLDNGMIERFRVQESVQRILNMKAKYTSWEKAFSPSGIDN
LARLQPLHTSLSTTAYNKSITVVRDQNHYLPLSRVIKADEELLLLTPLVKPLPASALFHL
LQNEATTVPHLGRSPSIDTNTSIMSGEQVFRELGRMLARYRNGKISHTSYTANGVRPLHE
NLLNRARGVVVVTADAGRNMYQNAFAKHISMLSKLAVGPDGTTREKPCVVVAVSSPFDFA
SDTSIGTYVCTYDFTESALQALVQVLYGELAPAGVLPGSFSQRPQTSLTRQQWLVESFSE
DRDSTALDGLLLQSQDEPSVHAAALKNATSSTFLLRDPDVEEAHFVVRNSSTKELFGFCT
TYYFKNSGVGHIGAIIVDPARRRLSIGHSLHDRAVRALLQKKGITKFQLGVRFPHVYLGI
PRLDPLEYKRQRQWFAKLGWNVSLSTPVATMTIRDLSIWSAPEGLGQALSLSDVKYDLVH
GAEYTDGMMEHLTRCAQTDVRGIYQRALGDKAGCGIIRAKRASDQAILASILMCRPGSKI
ARFIPSLSKQVGAACLSSPVISTMYSDRVTLFQGLVLLGIRQLKKQGVRTVLLDYTREDF
TIHSLKALGFTITNSFEEISSDPVHWTMMSAT

Enzyme Prediction     

No EC number prediction in CLCR_01063-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	77	303	2.4e-55	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.80e-70	18	410	6	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.96e-65	19	342	6	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.18e-32	24	342	5	305	beta-hexosaminidase; Provisional
185053	PRK15098	5.07e-10	103	394	119	409	beta-glucosidase BglX.
178629	PLN03080	1.31e-09	104	588	114	601	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	17	932	7	924
BCS15461.1|GH3	0.0	10	932	9	931
BAE65506.1|GH3	0.0	10	932	38	961
QMW48185.1|GH3	0.0	10	932	9	932
QMW36125.1|GH3	0.0	10	932	9	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	5.34e-90	17	763	11	700	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	6.22e-67	17	577	15	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.85e-45	18	577	47	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.38e-45	18	577	21	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.60e-45	18	577	51	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	9.51e-45	18	577	47	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	2.44e-36	15	577	28	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	5.12e-33	30	385	49	419	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|B4SRK3|NAGZ_STRM5	4.41e-28	22	312	1	285	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	1.47e-27	22	312	1	285	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CLCR_01063-t43_1-p1.