CAZyme Information: CLCR_01053-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_01053-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: putative endo-1,3(4)-beta-glucanase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1028	LGRB01000016|CGC3	109298.50	4.4880

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000016:170995-174342(-)

Full Sequence      

MHYTSSLALLTVSQAFLAAALPVPLVSGPSRHRDPDCDLELPGPYQNALLTSSSLISGAA
AASPVDSSVDSSSYSNDGPPAPTPSSSFDPDATEVHAAWSDGASPSYTSAVTFTDPHLNI
QTVNITGLPSSQVPTVTSANQNFPDTTGSLITTLETEGNPPVQPFPTSVPSVTSATLQPL
DSSVLFGNATAASTLSPVTGTITLPVSTFENVVTTQTVTSVPVQTTAVITAVTVLPTTIT
ADGSVVATSIAGTTVVNTTGTVLVETTLVASSTVIGTVATTLTTELGSISSLPTAASTCL
LSMGCYGQDIFQPVALGPPPNSIGIRDGHPVPRLGISDPGGPLETNKFYQNFVLGSQGSP
SFVMPYSLTWAKGSGNALSWGMAIAHLDQSQKVFGPINAAIPNTPAGYYINAIGIQSLIL
SAAEFGPNTALTTDSLLPFSVNVHLQPSLGSASVLTMPVVQGMPFVTGQYTNLQPAIQSS
VFFRNIAAAGQPAPGIYKYRVTLEDGKIWLIYAIPANGLTPNFQLVSSTLLRGLPNWYGD
IQIAKLPDDASESIYDNAAGAYPTAGHIAGSAHNTTAQYSLSWSKGGAYSANTTLLMFAL
PHHCHSFDSNTRGNMTNLTLATTTKGKATAVVGDYWVLEETSLPVSLGFAPWRPEDVGSQ
ESLALSPAALSIMQNISAIEASQNMSAQTNLNSMYYSGKALSKFAQLVYTMHDLLGQQDL
AKAALLELESCFEVFSTNRQQFPLLYDTDWKGLVSSASYVTGDPGVDFGNSYYNDHHFHY
GYFLHAAAVIGYLDPTWLVANKDYVNALVRDVSNPSSLDQWFPVFRSFDWYHGHSWAKGL
FESGDGKDEESSSEDAMFAYGLKMWGKTIGDASMEARGNLMISVLSRSLQNYFLMTSDNT
NQPADFIGNKVTGILFENKADHVTYFGADLSYVQGIHMIPIMPFSTLTRTQQFVHEEWMT
YFADGAVRQAIDIAGGWKGIVYANLATINPTAAYNFFTQPNFDWGWIDGGASLTWYIAYS
TLLGGATT

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	334	1019	1.2e-218	0.9823151125401929

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	283	1028	27	760	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	664	1017	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	5.48e-143	329	654	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBF89420.1|GH81|3.2.1.39	6.20e-297	308	1027	190	905
UDD56325.1|GH81	1.08e-296	307	1026	7	724
QRD82801.1|GH81	5.52e-296	288	1026	176	910
QMW28320.1|GH81	5.52e-296	288	1026	176	910
QMW40391.1|GH81	5.52e-296	288	1026	176	910

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.18e-101	307	1005	5	705	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.45e-100	307	1005	30	730	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.09e-97	307	1005	5	705	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.03e-25	746	999	393	636	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.44e-16	695	1010	361	671	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	5.68e-271	281	1020	169	899	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.65e-178	308	1026	1	705	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	7.88e-157	309	1020	401	1109	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.39e-152	329	1020	66	734	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	2.78e-150	306	1020	424	1138	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000384	0.999589	CS pos: 22-23. Pr: 0.7387

TMHMM  Annotations     

There is no transmembrane helices in CLCR_01053-t43_1-p1.