CAZyme Information: CLCR_00931-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_00931-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: polysaccharide lyase family 7 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	LGRB01000004|CGC1	27060.95	5.4601

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000004:604835-605605(+)

Full Sequence      

MPTFSRACSILILGFSCLAGAQNPSCAPGGNFNLKPWMLQLPIGSTGNPTTISSSQLQGC
SGYQDNGHHYFFTESGDGALVMKVPGSPASSGCVTTAHSTHCRTELREANPSTGGAASWQ
PSSSRNRLAVTLAVTVPDNSGHGTVIGQIHIDDSVSVKPVCELYYNKAGDVVMGVEQTTD
GGNSIFTSIGNIPVGQTFSYEIRYESNVLSVSLNGGAPRELDTYELNSPPSYFKVGNYNQ
GDSPSDVHFFSIDVQH

Enzyme Prediction     

No EC number prediction in CLCR_00931-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL7	32	256	9.1e-87	0.9953271028037384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400923	Alginate_lyase2	8.25e-55	32	256	1	222	Alginate lyase. Alginate lyases are enzymes that degrade the linear polysaccharide alignate. They cleave the glycosidic linkage of alignate through a beta-elimination reaction. This family forms an all beta fold and is different to all alpha fold of pfam05426.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX60664.1|PL7_4	1.00e-130	21	256	20	254
QYT01729.1|PL7_4	5.18e-127	9	256	6	248
OTA01262.1|PL7_4	2.10e-126	1	256	1	248
UKZ80219.1|PL7_4	2.28e-125	12	256	7	246
UKZ54441.1|PL7_4	2.28e-125	12	256	7	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NDE_A	2.50e-66	23	256	4	231	Chain A, Glucuronan lyase [Trichoderma parareesei]
1VAV_A	3.50e-14	33	240	2	200	Crystal structure of alginate lyase PA1167 from Pseudomonas aeruginosa at 2.0 A resolution [Pseudomonas aeruginosa PAO1],1VAV_B Crystal structure of alginate lyase PA1167 from Pseudomonas aeruginosa at 2.0 A resolution [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

CLCR_00931-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999748	CS pos: 21-22. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in CLCR_00931-t43_1-p1.