CAZyme Information: CLCR_00439-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_00439-t43_1-p1
• CAZy Family: AA11
• CAZyme Description: putative glucose sorbosone dehydrogenase protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	LGRB01000017|CGC1	50058.22	4.3979

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000017:372197-373759(-)

Full Sequence      

MRTFPSVIVAVLAASLSPAVAQSSSSCGPAPSGSIQPSLASGYRMQVVATGLSKPRGILL
DKAGNLLVVEQGRGVVSAHTLEENDGCVSVGTSTDLTPALSLNHGIEISQDGTTLYASSS
ESVYSWTYDQSAMTVSNNATLVGNMAGSDHTTRTLLLSNKAPGMLVVTRGSTSNIDFDSA
SLDSGRSQIKAFNISNVTSTPYDFNSDGLRLGWGMRNDVGIAEHPNSGGLYSVENSADQI
TRMGVDVHEDNPAEELNFLGYLNGTQYASQGGNFGYPWCFSAWGVEDLPDNDNLTVGSQF
AIDASPDSNNENRTDAYCAEQLPARLVFQAHMAPLDIKFNNSGTEAWVTFHGSWDRTDPV
GYKMSVVAFNAAGEPVDELQSRTAARDIFANQDNSRCPGDCFRPVGMAIDSQGRIFVSSD
ASGEIYLVSRASGSPTSSGYPSSASSSAPGSNAAGSHVKPAVLSGIAGLFCAMALMQ

Enzyme Prediction     

No EC number prediction in CLCR_00439-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	30	427	3.9e-165	0.9850374064837906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	1.59e-24	1	433	5	399	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
380207	ScyE_fam	0.010	46	101	1	59	ScyD/ScyE family protein. This family includes ScyE, a protein involved in scytomenin biosynthesis and export, and its paralog ScyD. Some members of the family contain a C-terminal PEP-CTERM domain that predictions anchoring to the outer membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS74351.1|AA12	8.21e-146	19	447	17	443
QIX02148.1|AA12	8.28e-135	37	437	40	437
QRD00226.1|AA12	1.24e-131	17	434	21	433
SMQ46525.1|AA12	2.11e-131	35	437	35	433
SMR45046.1|AA12	2.11e-131	35	437	35	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	1.39e-120	37	428	11	400	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	1.43e-120	37	428	12	401	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	1.48e-120	37	428	13	402	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	3.12e-78	26	430	4	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O51055|Y024_BORBU	1.55e-07	42	428	38	374	Uncharacterized protein BB_0024 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0024 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000346	0.999624	CS pos: 21-22. Pr: 0.9734

TMHMM  Annotations     

There is no transmembrane helices in CLCR_00439-t43_1-p1.