CAZyme Information: CLCR_00087-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_00087-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: Vanillyl-alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614	LGRB01000022|CGC1	68776.22	6.8163

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000022:30445-32573(-)

Full Sequence      

MSTSTTSPSTPPVYPAAYSGIPERLLHKAVREKSRLWENQSKEFQTPRKRGLAVPAGIGR
TEFVKALEELSQSLGKDHVVLNDQPLEDGWYMEHPNTHDAFMIMDEEETVSSASVYPGSV
PEVQLVVAWANKHLVPLYPISMGRNLGYGGAAPRVRGSVVVDLGKRMNKILDINPDDCTC
LVEPGVSFYALYEEIQKRGYKIWVDTPDLGGGSIIGNTLEHGVGYTPYGDHWGAHSGLEV
VLPTGELLRTGMGALPGSDAWQTFPYGFGPISDGIFSQSNFGIVTKMGMALMPDPGGCET
FLYTFQREDDLLLLIPANRRKVDTVRPLRIANILENVAQIRHATIEIAVSGKRRSEFYDG
TGPIPEEVLQSHLEKTPIGRCTWVYYGTQYGPEKIRKYKMDIIHQEFTKIPGAKRIDPET
LPKDHYFWSRAKIAGGQPDFEELSYLNWVPNGGHLGFSPVSPTRGADVLKLWKIAKERHD
QYGIDLFMTFCVGLRELHMINLIVYNRGSPERRKAVEKCMRSMIDDAANSGYGEYRTHLL
FQDQVARTYNWNDNALMKFNEKIKDALDPNGILAPGRCGIWPERYRDRGWEIGKDGRETS
EGQGVRPPAASTRL

Enzyme Prediction     

EC	1.1.3.38:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	52	590	2.6e-214	0.9942528735632183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	4.84e-30	110	577	31	454	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	5.78e-28	115	251	5	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
183043	PRK11230	9.25e-09	109	305	54	241	glycolate oxidase subunit GlcD; Provisional
178402	PLN02805	4.83e-08	115	295	138	308	D-lactate dehydrogenase [cytochrome]
397178	FAD-oxidase_C	1.96e-06	453	576	125	246	FAD linked oxidases, C-terminal domain. This domain has a ferredoxin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17285.1|AA4	4.57e-300	9	614	7	604
BCS28228.1|AA4	6.74e-295	12	614	10	604
CAP97133.1|AA4	9.56e-295	9	614	7	604
AEO67281.1|AA4	7.25e-294	12	607	12	601
QGA20504.1|AA4	1.05e-291	12	614	10	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E8F_A	5.08e-178	50	592	8	560	Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8F_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8G_A STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8G_B STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8H_A Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum],1E8H_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum]
1DZN_A	2.89e-177	50	592	8	560	Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum],1DZN_B Asp170Ser mutant of vanillyl-alcohol oxidase [Penicillium simplicissimum]
1W1K_A	5.79e-177	50	592	8	560	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]
1AHU_A	5.79e-177	50	592	8	560	Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHU_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHV_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHV_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHZ_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1AHZ_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],1VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],2VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum],2VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum]
1W1L_A	8.20e-177	50	592	8	560	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum],1W1L_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56216|VAOX_PENSI	2.98e-176	50	592	8	560	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
sp|P09788|DH4C_PSEPU	3.34e-112	54	580	9	515	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3
sp|P0DV35|D2HDH_XANCL	2.46e-14	113	322	42	243	D-2-hydroxyglutarate dehydrogenase OS=Xanthomonas citri pv. viticola (strain LMG 965 / NCPPB 2475 / ICMP 3867 / CFBP 7660) OX=1232713 GN=XVT_549 PE=1 SV=1
sp|P94535|GLCD_BACSU	4.30e-14	108	487	38	403	Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) OX=224308 GN=glcD PE=3 SV=1
sp|A4VGK4|D2HDH_PSEU5	5.37e-13	112	323	42	245	D-2-hydroxyglutarate dehydrogenase OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=d2hgdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CLCR_00087-t43_1-p1.