CAZyme Information: CLCR_00038-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_00038-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: capsule-associated protein CAP1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601		69551.45	6.3100

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000018:102501-104367(+)

Full Sequence      

MLRSRKFLALIVLLSTAACTLFLLRSPEQIQSLEQSASSILQDHHAHEENAPVLPASSLL
HPIHQLVSQAESDFQTLRARQSRSLNDAVAEYRRRYKLPPPPHFDKWYNFAKKRGVELID
EYDTIYHQLLPFWALDPKVIRERTREAIGFDNALIAVMIRNGKVTKIEGGGDMYAWQREA
TPIMLGDFIKYLPDMDLAFNIHDEPRVVMQHDDLQHHVEVAQNTNMPKAYNAPSLANSWS
SRADDLGEGIRIKEYKTTRFNRFAHQPTWSNSRISCPPDSAARSCLNDKCTDNTTAYSGL
PLGFVRNATAFSDICNSPSLEKSFGFFDRPNAFDVTHDLFPIFSQSKISSFQDILYPSPW
YFMGRVKYEPERDMPWEEKNPTMYWRGSTTGGFSRDGGWRRQHRQRFLTKIQPLNTAQIL
ELDNNSTAEESLWREKTVSMADMASYFDVKFTYIGQCDPGDCDAQREYFGTVEPVNMFDA
LASRCLLDIDGNAFSGRYYAWLLSKSLVYKLALFREWHDEWLRAWVHYVPLGLVGDEYAE
SVRYFDQEESGKVEGKKIANQGREWAQKVLRNDDLEVWYFRLLLEYGRLIDDNRYNIGFS
L

Enzyme Prediction     

No EC number prediction in CLCR_00038-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	318	590	9e-77	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	5.41e-21	337	589	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.21e-12	341	589	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA13289.1|GT90	1.45e-258	3	599	2	588
QKX56622.1|GT90	8.67e-251	3	601	299	888
UCK57446.1|GT90	2.43e-247	60	601	84	619
BAE54850.1|GT90	9.79e-247	60	601	74	609
BCR83603.1|GT90	2.70e-244	61	601	66	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	9.39e-08	318	593	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	4.84e-42	50	596	141	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	1.38e-07	341	590	164	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.77e-07	318	593	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8BYB9|PGLT1_MOUSE	3.11e-07	318	593	123	373	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2
sp|Q5E9Q1|PGLT1_BOVIN	5.46e-07	318	593	123	373	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.132157	0.867850	CS pos: 18-19. Pr: 0.7162

TMHMM  Annotations     

Start	End
7	24