CAZyme Information: CLCR_00005-t43_1-p1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: CLCR_00005-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: sterol glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
873		94721.42	7.5978

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiKSF	11240	N/A	59	11181

• Gene Location: location=LGRB01000001:34022-36939(-)

Full Sequence      

MGKEKAPARKPPAGAIPRRPTNSTIQTDNLPATDEPDSPLPEALLDDTTDILDDGRVSLN
LDSKLAQVFAQLIQMNDEEPPPSPPPAYTDVPDLESWGLPLNIVIQVVGSKDDVQPFLAL
GTELQRYGHTVRLATHSVFKEFVESAGLGFYSIGGDPAQLMAYMVKNPGLLPRIEALRQG
GFSKNKAMFREMLDGCWASCISPSEDGAPFVANAIIANPPSFAHVHCAQALGIPLHIMCN
MPWTPTRAFPHPLANISTKSTDPKLANYISYGMIQLLTWNGIGDIVQKWRATLDLEPLPL
SEAPFLMETLQIPCTYCCSPALVPKPRDWGKHIDVCGFLLRDPPHYEPAPELEAFLEAGP
PPIYIGFGSNAVDSSDAFVNAVLNAIKECGLRALISKVLGRPARIEYDEDIFWLDDCPHE
WLFQRVSVVVHHGGSATTACGLLNARPTIIVPFFGDQAFWGNMVARNGAGPRPIPYRRLT
TRKLSEALQYCMSSAAKEAAASIAAKMQAELGVKAAVQSFHRHLPANVMGCDLIADLPAT
WICTKSRTDIKISGAAAEILIQARRIKAEDLQLYKSKPIIIENRRWDFLTSSLSVSMGVS
YDIIASLSGFWRNPQRFRERQDKQRALARGSSQASSSMVGGEEEKSSGKDIAKMVGASAM
SVPHFTGVAVKGFVVDLPVAVAEGFRNTPKLYGENVPSHAPVTDWKSGLTVAGKTFAHQM
AEGLTDLLVQPVKGAARGGVVGFSKGIGKGALQTLTKPTAACMGLVGYTGQGIYKSLYAA
VHSQTKNSVASARRVQDKYFIRANGAEIAADLVVESFDRACQLNKKTGPLGLQPSTTSIT
LSRTTTSASNRTEQSSRITENEAPMYQERDRHH

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	172	523	2.5e-46	0.8403141361256544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.12e-61	101	523	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.05e-40	103	489	4	363	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	7.24e-21	103	250	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
227376	MRS6	1.40e-04	695	773	2336	2409	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92276.1|GT1	1.75e-272	12	819	25	855
CEI68149.1|GT1	4.69e-265	53	802	74	838
CEF86870.1|GT1	2.10e-261	53	819	74	858
QKD61343.1|GT1	5.55e-261	51	796	21	789
CZS83364.1|GT1	1.69e-260	53	819	74	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	4.49e-63	108	524	27	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	7.22e-63	108	524	47	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	2.82e-22	101	510	1	368	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	1.39e-21	101	510	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	1.51e-15	101	504	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	3.01e-108	101	528	156	578	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	2.22e-106	100	526	192	612	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	1.54e-61	108	524	1002	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q54IL5|UGT52_DICDI	5.68e-61	100	525	1163	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|P0CN91|ATG26_CRYNB	3.06e-60	66	554	992	1486	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000021

TMHMM  Annotations     

There is no transmembrane helices in CLCR_00005-t43_1-p1.