CAZyme Information: CKF44_06936-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_06936-t42_1-p1
• CAZy Family: GT66
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796		87567.06	4.9617

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022323.1:1568254-1571253(-)

Full Sequence      

MQRNPLNGRAFEGFSEDPYLSGMIAAGYINGLQEKGVGACIKHYVGNDMEHQRSSEYDLN
INGGDCAVDVRIPERALREIYLMPFLLAQKYAKPWAVMTSYSRLNGLHVSENPRILQTIL
RDEWKFDGLCISDWYGTYSTSESIKAGLDLEMPGPTMWRGQVAKWAKIAGKLDQEDIDKC
ALRVLKFAQNASRARPDIISAGYRPEKIIDDPEIKALNRRVAAEGIVLLKNDRNILPLNS
MVRLESETPSQNQVCDRRGTSIQSLAIVGPNSQSRTVSGGGSAYLLSSYAVTPLEGLSGA
AKERGIAVEHAPGCYGHKYLPMLDGWMTTADGTQGWTARFYNDDPRPTGGSAGAEPIETT
VLPGSRLRINDEKPTGLAENFYLRLETYLAAPSTGLFDFGMCVAGGRATLSVDEVEVIDN
GFKRKQTPGSSFYGVGTIEETGTFEFIKGRRYKVEVFYTSVVDGELLDRAANTQENQDGE
EEERQPTLVMAALRVGCAPQIVPQQAITEAINIAIKCDAVIAVIGTNMDIEGEGGDRPNL
ELPGLTNEFIQKLLSARPDTIIVNQSGSAVTFPWIDRASTVLQSWFGGNETGNAIADVVF
GDVNPSGRMSLTFPYKIQDCTAHLNWEAESGRILYGEGIFVGYRGYQETERDVMFSFGEG
LSYSIFEWGPLACNFSQLEKANDIKITATLTVTNRGPLAGAEVVQIYVTPLQSGSGFRRP
KQELKGFQKVFLHPGETKEVEIVLDKWALAYYNDSASCWTAERGGFAIQAAKSSRPKDKM
SSRCIWLPQTMIWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	2	153	8.1e-44	0.6666666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.60e-58	3	769	163	749	beta-glucosidase BglX.
224389	BglX	1.53e-44	1	239	124	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.99e-42	494	643	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.36e-27	3	745	162	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.59e-27	3	185	131	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR94194.2|GH3	0.0	1	796	1	796
AUB23815.1|GH3	0.0	1	796	1	796
VWO99100.1|GH3	1.49e-199	1	796	123	880
CCA68850.1|GH3	2.36e-193	1	796	109	850
QRV86694.1|GH3	5.88e-193	1	796	111	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	9.68e-159	1	796	105	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.50e-154	2	796	106	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.47e-89	1	775	111	658	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.93e-78	1	775	112	653	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.12e-62	1	775	122	703	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNN8|BGLJ_NEOFI	5.13e-177	1	796	113	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|Q4WLY1|BGLJ_ASPFU	2.09e-176	1	796	113	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglJ PE=3 SV=2
sp|B0Y8M8|BGLJ_ASPFC	2.09e-176	1	796	113	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q5BB53|BGLI_EMENI	2.39e-174	2	796	106	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q0CAF5|BGLI_ASPTN	2.94e-172	2	796	106	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CKF44_06936-t42_1-p1.