CAZyme Information: CKF44_06836-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_06836-t42_1-p1
• CAZy Family: GT47
• CAZyme Description: oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455	CP022325.1|CGC7	50716.14	6.3895

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022325.1:115847-117615(-)

Full Sequence      

MTAVNSNQGTGKLSGRVGIVGTGHRARLYTTAVASRANTSLVALCDTNDARMDWHNKMLR
EAGRPEAKKYAAEDFQKMLEQEKLDVLVVTTIDYTHDMYIIPALKAGIKVLSEKPMTTNV
DKCKAILNAVDESNGSLTVLFNYRYNPIHWKVAEVISKGEIGEVKSVHFEWLLDTVHGAD
YFRRWHRYKDRSGGLMIHKSSHHFDLVNFWIQSVPQSVFGMGSLAFYGKENGKKSGWGRS
YERARDAKEAENDPFAIHLGDEEGLKGLYFDAEHIDGYHRDMNVFADDITIEDDMSVLVH
YESGVNMTYHLTAYSPWEGYRVMFNGTHGRLELEVVENAFRLPIPKGSNNASEHVHGDSA
LPNEGHSKIILHKLWQQPVNVPYQEAKGGHGGGDEAMLDEIFGPKEGEEERKCPVNGLSA
DQKDGALAMAVGLAANESFKSGKQVFIKELLGGTL

Enzyme Prediction     

EC	3.2.1.49:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	16	174	8.3e-29	0.40100250626566414

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	2.42e-38	16	449	5	342	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	2.36e-17	16	141	2	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
397161	GFO_IDH_MocA_C	3.00e-08	154	223	2	70	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV32364.1|CE9	7.20e-27	16	398	396	709
QOY90270.1|GH0	1.31e-20	18	226	37	254
AHF92902.1|GH0	1.11e-19	16	334	19	318
UPK44969.1|GH0	4.89e-19	44	452	33	366
BBD45948.1|GH0	1.79e-15	17	222	38	262

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q2K_A	6.61e-12	16	219	32	227	Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_B Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_C Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_D Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_E Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_F Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_G Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_H Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_I Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_J Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_K Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_L Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_M Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_N Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_O Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_P Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I]
4N54_A	4.54e-10	16	222	16	215	Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_B Chain B, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_C Chain C, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4N54_D Chain D, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
4MKX_A	4.61e-10	16	222	19	218	Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23],4MKZ_A Chain A, Inositol dehydrogenase [Lacticaseibacillus casei BL23]
3EZY_A	1.03e-09	13	224	1	198	Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_B Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_C Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_D Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima]
1EVJ_A	3.39e-09	61	194	47	179	Chain A, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_B Chain B, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_C Chain C, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_D Chain D, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34371|YTET_BACSU	2.72e-65	70	450	58	422	Putative oxidoreductase YteT OS=Bacillus subtilis (strain 168) OX=224308 GN=yteT PE=2 SV=1
sp|P74041|Y816_SYNY3	1.92e-11	17	225	9	209	Uncharacterized oxidoreductase sll0816 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll0816 PE=3 SV=1
sp|A6KY05|G1092_PHOV8	4.12e-11	16	174	18	177	Glycosyl hydrolase family 109 protein 2 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0611 PE=3 SV=1
sp|O05389|YRBE_BACSU	1.22e-10	18	223	8	199	Uncharacterized oxidoreductase YrbE OS=Bacillus subtilis (strain 168) OX=224308 GN=yrbE PE=3 SV=2
sp|Q6M0B9|UGNO_METMP	1.82e-09	17	167	9	148	UDP-N-acetylglucosamine 3-dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) OX=267377 GN=MMP0352 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CKF44_06836-t42_1-p1.