CAZyme Information: CKF44_05991-t42_2-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_05991-t42_2-p1
• CAZy Family: GT22
• CAZyme Description: glycosyl hydrolase family 88

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443		50638.60	5.8188

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022332.1:22624-24569(+)

Full Sequence      

MALNTPNCHGLRTSTTQVTIMNKLQQIPAVFPRLYDVSDSIKVVEVAKKYEGPEGAPIRR
IPEYTIPQGSHEYHCSKVATSWTQGFFPGLVWLVEERRRLLPEAVESSYSGKEIMRLARR
YQESFKFLAKKAINHDQGFRFQLCYGMDFALTGDEEAKRVLVDAADSLVELYTPQVGCMR
SWTMMRKANMPDLWREDNLDEHYLVIIDNLMNLDMLYEATELTGDPKYAQVATHQAEKSL
NSHVRPDYTTYHVVDFNQDGSVKKCMTHQGYADESAWSRGQSWAIYGYAQCALRTGRKDF
LETACKLADKFFELLPESGVPWWDFDAPKPCPYDASAGAVTACGLLMLYRLLRPTDPRTA
EQYLTNSFKLVDDLMRECRTGKATLEGDKVIWGEGAWETILEHSTINGNELATKRLLDHG
LVYADFYFMQYGNELLKLRLEAN

Enzyme Prediction     

No EC number prediction in CKF44_05991-t42_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	79	430	5.3e-92	0.9665653495440729

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	4.98e-04	149	361	85	282	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB28341.1|GH88	0.0	1	443	1	443
AFR98229.2|GH88	0.0	1	443	1	443
UOH85098.1|GH88	0.0	1	443	1	443
KGB75742.2|GH88	5.45e-268	21	393	1	373
AUB28342.1|GH88	4.37e-245	1	323	1	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VD5_A	1.66e-46	66	394	27	354	Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	8.77e-46	66	394	27	354	Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
3WIW_A	1.13e-42	82	430	73	383	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	3.73e-39	63	430	49	384	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.80e-39	63	430	50	385	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	4.99e-48	82	430	77	389	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	8.55e-46	66	394	27	354	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	1.95e-38	63	430	50	385	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	1.26e-35	80	430	65	383	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	3.04e-32	80	430	68	386	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CKF44_05991-t42_2-p1.