CAZyme Information: CKF44_05258-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_05258-t42_1-p1
• CAZy Family: GH71
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588	CP022324.1|CGC7	65323.79	5.9099

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022324.1:862958-864836(+)

Full Sequence      

MVHAATHPKDAPKNFDFIVLGGGAGGCTVAGRLAENPNVSVLLVEAGVNNPSEITDITTP
AKAMGLRNSQYDWKYKTTMIDRPDYTRIEKPNTRGKVLGGSTALNYYTWVRGSAATFNDW
EEFGGSTWNWENTKDYFNKSTTYHDDLGLFPDDIKSIGNKGGPVDISHSDLVPELKPWRD
ALERAWVSKGHELTVDVYNGVQKGLFKCVNSIYKGVRSTAAAFLEGKPNITLASSTISKR
IIFEDKTAVGVTVIGPDEREYDFYANREVIVAQGVYESAKILMLSGIGIKSDLEALSIQC
VVDSKHVGQNLQDHPILSHVFKIKDGFGLDNHLLRAGAEHDGAISSYRKNHNGPLSSGLL
ELVAFPRIDDRLENHKQYRDYKAQNGGKDPFGPDGQPHFEIDFVPMFADAFQWHFPTPPT
GDYMTVIVDLMRPISQNGVVKLTSTDPFEQPYINLNFFSHDLDLIALREGVRFVDDVLMN
GEGMKDIVECDYPWPMPRNSDEGMIRQILERSQTGFHPCGTARISKDIDHGVVSPELSVH
GVKNLRVADASVFPLIPDCRIQNVVYMVGEKAADFIKAAHPDLYKETK

Enzyme Prediction     

No EC number prediction in CKF44_05258-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	578	8e-144	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	9.74e-93	15	577	6	532	choline dehydrogenase; Validated
225186	BetA	1.12e-92	8	581	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.35e-38	438	572	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.18e-24	15	569	56	569	Protein HOTHEAD
366272	GMC_oxred_N	3.85e-21	94	316	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB24176.1|AA3_2	0.0	1	588	1	588
AFR94515.1|AA3_2	0.0	1	588	1	588
KGB80031.1|AA3_2	0.0	1	588	1	588
UOH84707.1|AA3_2	0.0	1	586	1	569
BCS02092.1|AA3_2	3.96e-293	14	585	8	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	3.15e-259	13	584	5	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	9.00e-259	13	584	5	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.57e-258	13	584	5	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.16e-64	14	578	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.16e-64	14	578	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	7.47e-60	13	579	5	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	3.01e-57	13	576	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.01e-57	13	576	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|B1Z034|BETA_BURA4	2.21e-56	13	581	4	537	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) OX=398577 GN=betA PE=3 SV=1
sp|Q0B711|BETA_BURCM	3.06e-56	13	581	4	537	Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) OX=339670 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000018

TMHMM  Annotations     

There is no transmembrane helices in CKF44_05258-t42_1-p1.