CAZyme Information: CKF44_04963-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_04963-t42_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443		46474.42	4.3504

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022324.1:93774-95312(+)

Full Sequence      

MQIGPLVPLLALLAAPALARSSLHPNAAAHRRQDITHERVNSAVERRETLAQSQPRALSE
KPNKRKITRRGGRSCRARNSTATASDSATASTPSQNSTAALPDSTDSYVASAVSSGAESS
SSTQAPVENTSSSSEDVAATTSSIENIAALQQPSSSSSAEDSSTAANSTSVASAAATSSA
AATSSSSSSSNSTGSYTPNGIKAGVSGDDPLSFLQGHIGWYYDWNATPSGSASGASAVNM
LWGAGTVDSTDASRLSAFKALTTAPQYIIGFEEPDCSTPGSSNIAVADAASLWDSTIAPW
KDQGSILISPSMCHQAAEEYTKWLSAFSSQISTSWDITNLHINKNSMDGVKTDIDYYYNT
YGKPIWVTEFACVDDSTDFVPCTDQSEINTFINDIVALFESDDRVQAYAYSTGEGLSPEW
DMISNGALTESGQTYLTAISQYH

Enzyme Prediction     

No EC number prediction in CKF44_04963-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	215	435	3.5e-58	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	2.21e-72	204	435	4	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT06237.1|GH128	6.05e-80	197	443	23	270
PNP47955.1|GH128	2.86e-79	197	443	7	254
UKZ58231.1|GH128	6.78e-79	197	443	23	270
UKZ69748.1|GH128	2.27e-78	197	443	7	254
UKZ94447.1|GH128	8.04e-76	195	443	5	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UBC_A	1.94e-251	21	443	22	444	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UBD_A	2.14e-80	197	443	29	276	Chain A, Glyco_hydro_cc domain-containing protein [Trichoderma gamsii]
6UAQ_A	5.04e-11	200	438	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	1.23e-10	200	438	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAS_A	2.99e-10	200	438	23	262	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199A mutant) from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaripentaose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	2.41e-15	212	437	312	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001867	0.998112	CS pos: 19-20. Pr: 0.9716

TMHMM  Annotations     

There is no transmembrane helices in CKF44_04963-t42_1-p1.