CAZyme Information: CKF44_04449-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_04449-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		61374.58	9.3685

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022329.1:892322-894323(-)

Full Sequence      

MARFPFLRTLLRGNTPAKLLLLFFALVFFFAFPFSSRHTSIFADPALREEAKAAPLSELG
TVYERVRLGILDARRFNGSHAAEKLRAPKTLPDGTLNFDPDLETYVGRLRWFVNNYFRSA
PPHIQIAGSNTLKNLVRRLPAKHRDGDFPTKVWATHPRGMDGVESGFELWGELLPFPLPP
SLANQLSPNHEVVFLKPARVGKEWDVEVLDDDGLDNAMSEWTGEEIVRGVKGEGKWSQLW
GKLDKGVLRADLFRYVSMLVEGGIYSDSDTMPISHPYVWGLHAPSILDQDLEVLNDLMVS
SLLPKFPPHNRSPQTNSRSIIDSDNSTYTPPYPGLRLSRRAPVYTDENPNPSSILNPSIS
MVVAIEWDSQIGRTLGMWKQWTWFRITRSWKDCCFPRGLEMVQNLLVSKPFHPIMMDTVA
TIAQLVETGVYKELTPLELTGPGPFTDAVFRYLLVQYGVTPDELRALRGPVRVGDILILQ
EEAWHAPRKAIQRLKTFVDSLRLKLGTNRHGRYSPWLFGLGYKDWKSGGVKVAYHGLTGI
WK

Enzyme Prediction     

No EC number prediction in CKF44_04449-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.79e-06	246	300	144	200	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.98e-05	246	285	53	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB27156.1|GT0	0.0	1	542	1	542
AFR97169.2|GT0	0.0	1	542	1	542
UOH83342.1|GT0	0.0	1	542	1	542
AAW45413.1|GT0	0.0	1	542	1	542
KGB76775.2|GT0	0.0	1	542	1	542

PDB Hits     

CKF44_04449-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.53e-08	208	479	176	361	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.639537	0.360461

TMHMM  Annotations     

Start	End
19	36