CAZyme Information: CKF44_02871-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_02871-t42_1-p1
• CAZy Family: GH13|GH13
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	CP022323.1|CGC3	46716.06	8.6451

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022323.1:563770-565195(-)

Full Sequence      

MAKLSPLTLIVITACFSRILHLTILSGLSKALPLFDTSPSLLLPSPPPALRWDAIHFSSI
AYIGYEYEQQVAFQPGWLAVMRLAGEGVRFIRAAPVVELNDVILGGTIVANFAFVAATLV
LYKLTERIFNPTFAFLTSLLYLLPPTATPSAPYTEPIYSLLTFSGIYLLSIKRQMVLAGL
CFAGATTVRSTGIFNSITLMCFSVFGDAHILDLDVSKIRKMWKPFLPAFLAVAPFLMFQH
YSETVFCTRESKLTSTARPWCSNSPPISYGFVQKLYWNVGPFEYWTVAQLPNIALVIPII
FSSLIGFIKYFSHLVSSSQVLNHGTEENPPPPILFELYSVHLLTMALLLFTSHTQIALRV
CLGDPVVWWNAVKLGFDNVQMGETPMGQVKMNKFGRYWIGWTVVWGAVAVVLWAGHYPPA

Enzyme Prediction     

No EC number prediction in CKF44_02871-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	48	420	3.7e-95	0.8722358722358723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	4.39e-35	50	420	58	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	5.78e-15	52	369	74	361	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR93820.1|GT76	6.08e-311	1	420	1	420
AUB23397.1|GT76	6.08e-311	1	420	1	420
UOH80020.1|GT76	2.03e-309	1	420	1	420
EAL22094.1|GT76	1.33e-276	1	420	1	423
AAW42711.1|GT76	1.48e-273	1	420	1	423

PDB Hits     

CKF44_02871-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CP63|GPI18_CRYNB	2.36e-277	1	420	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=GPI18 PE=3 SV=1
sp|P0CP62|GPI18_CRYNJ	2.63e-274	1	420	1	423	GPI mannosyltransferase 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.83e-31	35	420	29	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.90e-25	22	420	33	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q5KR61|PIGV_RAT	1.35e-24	51	369	65	415	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.609835	0.390163

TMHMM  Annotations     

Start	End
7	29
102	121
128	147
152	171
192	211
285	307
394	416