CAZyme Information: CKF44_02834-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_02834-t42_1-p1
• CAZy Family: GH13
• CAZyme Description: sterol 3-beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1615	CP022323.1|CGC6	179331.78	6.1565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022323.1:654464-660604(+)

Full Sequence      

MPPPISPTPHPLQPPFPPTAIAPDPNPPPHHQQAAESLVNTAAQHVAPTCPPTSDESPQM
ADQATHSSDDSLISSRQTPQQEETESAIISGTLPDEMEPAKDAQTVRFSSPSPTSYSTHK
YPTEVTAGLNEPLMSSRAPSTASSQTPESSPDFRASRDIGSMNADRSPPFFILAVLRIPV
IHNSSTTPPASVHVQQIRMGASALVSALNALPWEEDDESDDGEDDDEFMEPARGSSSAMY
ERKQRPQISRLGSSLSTIRPMSSSSPTHAKAPSTSHGSHPTHTLHFPFRQNAIARRARRP
GTTELDYQYATPETSSRRTNAAGSEASSEGEVPLPKGFVSHPNLIIPSGEGEAAAHADLK
LINDRICKEQQIADVEEQAEILRSAEEQRMRLGKEFVRHKNRDSADLNVDAALREGGSEG
DDVIEEQMQTNEAEKRITRKERLAERLMEVFGLEEREQVLEEMKCWLLRSVMLKGYMYLT
KKHICFFANMPNENNLLVKSGPLSKKASRSKLNTKFWVVLKNDVLSWYESTSDPYFPKGN
ISLQYCHSCDAVDGTRFKVRTSERNYTFTADTESSRDEWVKAIQKVMFKTQHEGETIKLI
IPLEAVVDVDMSPTLEFTETIEIKCIDAEDQMSVDSYFFASFPNNDHAFSAIQKLVRERP
SPPELPRISSATTIHANQESLDTSHATIKRHGTDSSAEKLVMASHRPFRKISSILKPLIL
KSSGEEPHEEHSESPHHDDDDEASHLPHIEAISNRQRPEEESDNDDFDGYPPRQIGPPPP
SMNDDARNWRPSWIRKPASKLFGNSPSGSFVSHPGRSPTDSPTTVAESGPSLRSRTGRTK
QSSVTEVLEPPIHHEEEGSEDEMSSKPSVVDSNSAETARKRAARLSWTSETSSGSQMIKS
KSEFSMLGSESGHSESAETIRKFRSFFALSDKEDLIDHFPGYLYRVLPMIIPIRDLYGLK
AQKAFRFGHSGLTVVIKGHEEIFIEFRSASRRKACIILLEERMEAVRLSGENTTIDSHKV
EVRIMEDLDESIPVEPKSPWPVSPSPLFGSTTSTSFLEFKPEPMKIACLTIGSRGDVQPY
IALCKGLQAEGHTTKIATHGEYKDWVEGHGIAFENVGGDPAELMQMCVDNGMFTVSFLKE
GLQKFRGWLDDLLNSSWEACQGSDLLIESPSAMSGIHIAEALRIPYYRAFTMPWTRTRAY
PHAFAVPEHGRGGPYNYMTYTMFDQVFWRAISGQVNRWRRNVLGLDATTFDKMEQHKVPF
LYNFSPTVVPPPLDWTEWIHVTGYWFLDKADEKQGEKSWTPPQGLTDFIDKAHGEKKKVV
YIGFGSIVVSDPEEMTRCVVEAVMNSGVCAILSKGWSDRGSKKGEPKGDSEGADGVKYPP
EIFAIDSIDHGWLFPRIDAACHHGGAGTTGASLRAGIPTIIKPFFGDQAFWAERVESLNV
GSAIRRLTSHQLASALIKATTDEKQISKARVVGDMIRKENGIARAIEAIYRDLEYAKSII
KSPPSTDDRTPEKISSLLHPLTTADLSLNRVRSRSRSRSRSSQGRFSPRRYPVDDDGWSV
VSGGSRSRSGSASAVASPERRPLNVGSTLGSHVFKTALLPNPFGKWRNLEEGDDR

Enzyme Prediction     

EC	2.4.1.173:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	1067	1491	1.2e-57	0.9764397905759162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	6.85e-76	1064	1489	1	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.64e-53	1063	1491	1	400	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
275402	PH-GRAM1_AGT26	6.96e-53	477	587	1	116	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
397255	Glyco_transf_28	5.44e-31	1066	1201	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
275403	PH-GRAM2_AGT26	9.08e-27	932	1000	1	93	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 2. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR93859.1|GT1	0.0	1	1615	1	1615
AUB23442.1|GT1	0.0	1	1615	1	1615
UOH80058.1|GT1	0.0	199	1615	1	1435
KGB77647.2|GT1	0.0	1	1615	1	1601
ADV21172.1|GT1	0.0	1	1615	1	1583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	9.22e-164	1065	1525	21	472	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.83e-163	1065	1525	41	492	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	9.52e-23	1064	1492	1	401	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	4.06e-18	1072	1491	9	383	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	1.41e-14	1064	1485	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CN90|ATG26_CRYNJ	0.0	1	1615	1	1585	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	0.0	1	1615	1	1585	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1
sp|A7ERM5|ATG26_SCLS1	1.28e-271	432	1512	198	1377	Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=atg26 PE=3 SV=1
sp|A7KAN4|ATG26_PENRW	7.64e-265	443	1501	232	1309	Sterol 3-beta-glucosyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=atg26 PE=3 SV=1
sp|A1CYS1|ATG26_NEOFI	9.66e-265	443	1501	235	1336	Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CKF44_02834-t42_1-p1.