CAZyme Information: CKF44_01214-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_01214-t42_1-p1
• CAZy Family: GT90
• CAZyme Description: alpha-1,6-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	CP022325.1|CGC4	49390.01	5.1143

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022325.1:901523-903192(+)

Full Sequence      

MPLATLPHPRLLPLILALLFIIFALSSLFSLFTSSSSPSILNFIPTALVRGERTPTGYSA
TGSKGNTISIQNVLDAGARHVAESSRLFDAIGAKRDLGIDLGGNWTLQSYADYLKNTWQE
FLGPQGSNNADHPTLQTALSYTSLLPREQESETAIPNLIYTTDLLEPQQLPEQFQSWITQ
NPDWTTMFVGDEEIDTWLENSLGATGIKKSRAQEELLALKEDYGVVRADLFRYLVLLLNG
GIYTDTDTASVLPIAQWARNPTIAPVDPLLTAIPQLISIIQDPSQSLASTPSTSKPSLVV
AIESDALSTGANWREQSFARSIQIVQWTIMANRGHPVLLDVIGMALRKSQEIRQMGSNNE
EVRKEDVNILDWSGPGVFTDAVFRYLLVRYGFHPTQASGLKDPLQIGDVIIMPVHSFRAD
ASEGFQGNHRVVWHGFFGRWKGKTDNK

Enzyme Prediction     

No EC number prediction in CKF44_01214-t42_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.91e-14	120	338	47	236	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.30e-10	173	257	7	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR94929.2|GT32	0.0	1	447	1	447
AUB24663.1|GT32	0.0	1	447	1	447
AAW42866.2|GT32	1.15e-258	1	445	1	438
KGB74945.2|GT32	3.40e-258	1	445	1	439
UOH80832.1|GT32	9.47e-252	1	377	1	395

PDB Hits     

CKF44_01214-t42_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	9.26e-28	114	441	58	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.82e-26	155	441	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	4.93e-19	225	418	196	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	6.73e-17	150	445	91	474	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999933	0.000113

TMHMM  Annotations     

Start	End
12	34