CAZyme Information: CKF44_00850-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_00850-t42_1-p1
• CAZy Family: CBM13
• CAZyme Description: plant-inducible protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		50588.13	5.5316

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022321.1:2251268-2252870(-)

Full Sequence      

MTTAHTAEEIFTVQAKAQLDSEKPQASSVPSTPLALDLDSDRATHLINLLTDGLVSIRDE
DGRFLLKLDDGTLIDTKGWEHPTVFSWEWTHGIALTALCHHSAISRTSPASQKSLDTAIA
WFNSQYARTSGKGAPKNINTFSPFYALASFLEDGREKDEQGKWRAWCEDWAQWVMRDDGL
PKTEEGGFQHITYANAHPQNLWDDTLMMSAIPLAKLGILLNQPSWIDEAVYQFLLHIRYL
ADPVTGLWYHGWEFTPGKQGRAAELEGGQGWKGGKNGHNFARAFWARGNCWITLAIPMLL
SILSPTSSSPHPKPLHPTDPTARFLIQTWTRQVDALISLQDPNSGMWHTLLDDPESYVET
SASAGFVAGIYMGLRMGLLPASKAPSYRAAADTALAAILTQIQPDGQVANVSFGTGMGET
LQFYRDIAITPMPYGQALVMHALVEWERLNEVRGEGK

Enzyme Prediction     

No EC number prediction in CKF44_00850-t42_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	76	448	7.4e-113	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.42e-80	54	449	8	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	5.61e-69	57	449	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUB22466.1|GH105	0.0	1	457	1	457
AFR92981.1|GH105	0.0	1	457	1	457
AAW41249.1|GH105	0.0	1	451	1	455
ADV19987.1|GH105	0.0	1	452	3	454
KGB75254.1|GH105	0.0	1	455	3	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	2.09e-95	47	448	12	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	1.51e-94	41	448	24	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.11e-94	46	448	30	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	1.89e-14	178	382	107	286	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	2.61e-09	192	449	188	413	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	2.26e-29	85	445	27	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CKF44_00850-t42_1-p1.