CAZyme Information: CKF44_00799-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_00799-t42_1-p1
• CAZy Family: CBM13
• CAZyme Description: cellulase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789		85302.39	4.0707

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022321.1:2114992-2117516(+)

Full Sequence      

MFAFTYIAALLSLISVLPSALAGPTAGTTYAISPNQHPSMCLAPAHGWEGTDVVLKDCDE
DDTTWLWTGQSFQNTATNFCIDIRDSGAWSGNKAQVWGCFSYNTNQQFSVEESMIHWNGF
CWDLTDGSSSAGTKLQIWSCYSYNDNQQWTFTEIEEVDECDATSITETATIMSTSTASVS
DLSTSTASASASNITEAVTASESLTASATDSDYQVNPPASAIESAYESINATASVAESGY
ESINATASATLSASDTLSAETSTATNSSIGEGLWSPHKSSSVSSDDWSSETATDSNTKWW
ATSTSSDSWASATASASNPWQNASQSDSWNSTSTASNPWETAVSSSQAWNETSTDSWGAS
ATATATTSDSYGNATSTSASSAITATATVGTISSGYLQTSGTKIVDSDGNEVILRGTNIG
GWLVLEDWMCGITDNSGTSDRFSLSTLENRFGTDQARTLVEAWAENWLTTNDFDELAAIG
FNVIRLPFSFRTVQNADGSWRDDAFTRMDWAIAEAKARGIYTIVDFHMWPGQEADYSAIS
ENTDEGQSQRDAVGEIWKKVATHYLGESSICAFDVINEPTGSYGDYLQQDLYKAVRSVDS
DRIIIHESISTDPSTYGWTNVIYSLHEYDMMGSDLSSNKATWANGVQAYIDLWHGYNIPF
MLAEFMADGETLDFMLNSMNSQGISWLTWAHSTVNMGRWGIWNHEAFNVDVSSDSYDTIY
NTWTNMPSTFHTSIYDQMKAAATGSTNVSRKRDLAPAARTTKRLHGSHGGRSRRNGVAHA
VRGAAGVSI

Enzyme Prediction     

EC	3.2.1.39:5	3.2.1.14:1	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	446	690	2.1e-54	0.9885931558935361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	2.82e-20	463	690	19	267	Cellulase (glycosyl hydrolase family 5).
395527	Ricin_B_lectin	2.49e-17	35	149	7	126	Ricin-type beta-trefoil lectin domain.
225344	BglC	3.26e-12	412	629	16	243	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	1.38e-11	72	153	5	86	Ricin-type beta-trefoil lectin domain.
238092	RICIN	6.99e-11	38	151	9	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFR92930.1|CBM13|GH5	0.0	1	789	1	789
AUB22412.1|CBM13|GH5	0.0	1	789	1	789
UOH79756.1|CBM13|GH5	0.0	1	789	1	789
AAW41305.1|CBM13|GH5	0.0	1	789	1	847
ADV19959.1|CBM13|GH5	0.0	1	789	1	876

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	1.44e-11	406	638	8	265	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	2.48e-11	406	638	3	260	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	2.56e-11	406	638	9	266	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	3.30e-11	406	638	3	260	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	3.38e-11	406	638	8	265	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	4.10e-26	396	632	3	252	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A1CRV0|EXGA_ASPCL	6.09e-21	413	637	41	279	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|B0XN12|EXGA_ASPFC	1.16e-18	413	637	41	280	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q4WK60|EXGA_ASPFU	6.63e-18	413	637	41	280	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|A1D4Q5|EXGA_NEOFI	6.70e-17	413	637	41	280	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999770	CS pos: 22-23. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in CKF44_00799-t42_1-p1.