CAZyme Information: CKF44_00746-t42_1-p1

Basic Information

• Species: Cryptococcus neoformans
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus neoformans
• CAZyme ID: CKF44_00746-t42_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628		67908.52	6.5304

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CneoformansKN99	6967	N/A	0	6967

• Gene Location: location=CP022321.1:1957606-1959969(+)

Full Sequence      

MLRPRNHPANTSSAAEPDTPMSHYPSGHVHAHPDAAGANAGAHVEAEYFPDADHEAGAGA
IPRRASAGTAAGVGIGEKRSVNERKGLTGRRRLGFTLKGLMGRKGKGSKFGLTQKGWMLM
TVVVGLLIFLKLVFSSNDLDDHHQTYDTAHLIPRDYLNHSLTDPAPFEFCPVFGPGDAIA
AKRGQFELLRSRLHTGTGARVQRILQKAMSGAPITISILGGSVSACTGAGDDPTHEKCYP
HRVFDWWNTVFPHPANELTNGATPKTDSAYYAYCNSHHLPDKTDLVILEFDSADPNDPEW
LQHFELLVRSVLVRPEMPAVIILGHFSLQVQAQNGFAGPELLHNVVGQFYDVPHISTKGV
LYEHYLGTPDKARSAYYVDPNHPNFAGHDLIADVLISYLQSQVCAGWSAINGHGYDVPAL
GTEGDSTAAGTPSLLGGVGLRKGMPGQDPGDGSSAGSYLADRYQGLRVPQIRLADRPNDV
QAFREIEPFCVAASDLVNPLPPTLFFGNGWATYHPPAKGNVVEDRHYWYADRPTARLRIP
LKLGAGDVGIYFLQSPPDKPLGVVKCWVDDNVNGAKELHGTAEVEDVIATLVMIDRGVER
GSHFVECELQGEPGGSSPPFKILGIFTT

Enzyme Prediction     

EC	3.1.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE17	219	389	7.2e-24	0.9878787878787879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238141	SGNH_hydrolase	2.30e-13	216	398	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV99024.1|GT90	5.22e-184	111	628	643	1144
QRV84988.1|GT90	1.46e-183	111	628	643	1144
QRW26062.1|GT90	3.59e-151	114	628	286	753
UQT31642.1|CE17	8.23e-20	200	400	19	211
BCJ92770.1|CE17	1.62e-19	190	400	9	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HH9_A	1.05e-19	200	400	19	211	Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82],6HH9_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans co-crystallized with mannopentaose [Roseburia intestinalis L1-82]
6HFZ_A	1.47e-18	200	400	19	211	Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_B Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_C Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82],6HFZ_D Crystal structure of a two-domain esterase (CEX) active on acetylated mannans [Roseburia intestinalis L1-82]

Swiss-Prot Hits     

CKF44_00746-t42_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.982472	0.017547

TMHMM  Annotations     

There is no transmembrane helices in CKF44_00746-t42_1-p1.