CAZyme Information: CIMG_13167-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIMG_13167-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: beta-glucosidase 5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489		51779.61	4.7987

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisRS	9905	246410	148	9757

• Gene Location: location=GG704913:464550-466139(-)

Full Sequence      

MTGEPTLVPEPVTEKTTTIRSTSYTTVTVSVTPTEAVQTPTEALPTPIVTVYPTPGTYTV
EPTTIIVTKETTVCAATTTGLSPGEHTYGGVTTVVDSPATLTVPIATVKPEGSTFTSVIE
KTTYVCPTEGTYTIAPSTTSVSKSTVIVYPTPAIITSGTYTQPGATVTVTETDYVYVCPT
PTGIEPPKVDPPKVEIPDVEPPKAEPPKTEQPTPPKQDKPEPPKTPQIGGGEKWGMTYSP
YTDDGQCKGAGDVKADIAIIKQKGFKTVRVYSSDCDGLKNIGNACKEYGLRMIIGVFISN
TGIEGAQKQVTDIVEWGQWNMVDLVVVGNEAIFQGHADATSLASFIGSCKATFKKAGYNG
PVTTTEPLNIWQANASKLCGVIDILGANIHPFFNSDVSPADAGKFVKGQMDILHGLCNKK
VINLETGWPNGGGNNGKAISGQSEQVTAIKSIVKAVGSDSVFFSFRDDRWKEPGPLGVEQ
NWGCINVFG

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	254	486	5.8e-18	0.9131832797427653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.99e-53	226	488	39	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
223021	PHA03247	1.97e-05	36	241	2752	2963	large tegument protein UL36; Provisional
275319	predic_Ig_block	2.63e-05	179	226	71	122	putative immunoglobulin-blocking virulence protein. Members of this family are putative virulence proteins of Mycoplasma and Ureaplasma species. Members share a region of sequence similarity (see TIGR04524) with protein M, a Mycoplasma genitalium protein that binds a conserved light chain region of IgG and blocks its protective function of antigen-specific binding. The seed alignment for this model includes an N-terminal signal-anchor domain and a proline-rich linker domain, and a C-terminal extension, in addition to the protein M-like domain recognized by TIGR04524. [Cellular processes, Pathogenesis]
411407	PspC_subgroup_1	2.78e-05	179	245	420	502	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
236766	rne	6.72e-04	35	223	856	1033	ribonuclease E; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAL09829.2|GH17	2.13e-317	1	489	49	537
QSS72686.1|GH17	5.49e-151	49	488	157	592
QMW26283.1|GH17	1.05e-139	49	488	162	601
QMW38366.1|GH17	1.05e-139	49	488	162	601
BAE55626.1|GH17	1.05e-139	49	488	162	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.73e-09	227	485	29	282	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.13e-08	227	485	29	282	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8MXP5|BTGE_ASPFN	1.86e-140	49	488	162	601	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	1.86e-140	49	488	162	601	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|Q4WC60|BTGE_ASPFU	2.80e-133	72	488	137	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|B0Y9Q9|BTGE_ASPFC	2.80e-133	72	488	137	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|A1DBG6|BTGE_NEOFI	7.64e-130	72	488	137	551	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000019

TMHMM  Annotations     

There is no transmembrane helices in CIMG_13167-t26_1-p1.