CAZyme Information: CIMG_10211-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIMG_10211-t26_1-p1
• CAZy Family: GT50
• CAZyme Description: Glucose oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612		67675.69	4.9235

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisRS	9905	246410	148	9757

• Gene Location: location=GG704915:1011418-1013429(-)

Full Sequence      

MSIPPNNPREFASQVFDYLIIGGGTAGLVVASRLSEKPHLKIAVIEAGPAVFDEPLINEP
ELFGEAIGTKYDWQFETEPQPGLAGQRVPWPRGKVLGGSSALNFLVWNRGHKEDYDAWVA
MGNQGWGWDDLLPSFKKSETFHEPSLSEQEKNYSYFEASSHGIEGPVKTSHIQRFAPSLK
YWHQTLENLGVEVNRQSYSGANAGAWNLISAFDPAAYTRSFSANRYYLPVSQRPNLFLLT
EATVEQITLEKHGEEWIAKGALVRYGEEKFIVKASKEVILSAGSIQSPQLLELSGIGNPE
ILTAAGIPVKVANPNVGENLQDHLLTTFVYEMRTPSNSPDVNLLPPQKVEETSDGPKVEE
PSRAFLPGPAAYCPLFRMLTNEELEDITTRICPEILKSTKARETRLRDAFLSGKMLGAIE
YIWYGETIWNKAFKGEPGKKYATIVQMLQYPFSRGSVHIPPMRDSRPITVDEKPIIDPQY
CVGDGKIDLDVMKVGQMFADKICATEPLSHVIAGRVFPAKADNDDDDADVIDDYLRNNIG
TEFHPIGTCAMGGFEGAKAGVVDDKLRVYGVRGLRVVDASIMPLHISAHTQATVYAIAEK
AASMVLEDERSE

Enzyme Prediction     

No EC number prediction in CIMG_10211-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	15	608	6.9e-172	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.65e-101	16	610	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.93e-92	12	606	2	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	7.97e-35	85	324	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.92e-32	451	601	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.63e-16	2	608	39	579	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12647.1|AA3_2	0.0	1	612	1	612
QRD87580.1|AA3_2	1.46e-232	10	608	6	607
QMW26329.1|AA3_2	1.46e-232	10	608	6	607
UCK58874.1|AA3_2	1.94e-230	10	608	6	607
QMW38412.1|AA3_2	2.08e-213	10	608	6	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.13e-77	13	611	3	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	5.71e-66	2	605	26	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	3.74e-64	16	609	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.98e-63	16	609	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	9.25e-61	16	610	6	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	3.67e-100	10	608	8	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	3.67e-100	10	608	8	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	9.42e-95	7	606	38	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	9.42e-95	7	606	38	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.09e-93	3	608	1	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.992271	0.007738

TMHMM  Annotations     

There is no transmembrane helices in CIMG_10211-t26_1-p1.