CAZyme Information: CIMG_07841-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIMG_07841-t26_1-p1
• CAZy Family: GT21
• CAZyme Description: Glycosyl transferase family group 2, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
929		103763.44	5.7793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisRS	9905	246410	148	9757

• Gene Location: location=GG704913:2911536-2914719(-)

Full Sequence      

MFWRSAKSDNLESTQPSAQVSTENVSPRLSGCSSAQGTASRPFSQSENRMTIAGIDEDSK
YRAIIKYLHARLATNQWYSLPTDPTVEYHGLLLRKSRGSYISEPENVHPLLLAAVQKINV
SVAFTMSTETTRIILSLLQPNQTELVLPNGFQVQVIDSLADIACSPSSSVKKFQYVAFIR
EEGFLLVWHDELDKILLHAEDVESKLLSFICGTSTSVFASSIPRYPLQRSPLHSAANSTH
QFTTRRSKEAGDVVNQTSSPPDEEAANPVESLDRPVALTSSIFVGLGACLIIVLILGFGV
SNLVLQVLVDGKWSRLGLLATIPVFMLFSVFFVIVIFTDIFQAIGPIKTLKTNSRFYSAL
RPDLAQAYSLGFKPPRLTIQMPVYTESLNGVIIPTITSLKAAISHYESHGGELSISILLT
FRYLTGNVSSGAATIFVNDDGLAYLSEEEREDRINYYHDNNIGWVARPRNNEDGYIRKGK
FKKASNMNFALNISNKVEDKLLGMLSETLETTDMVDVGREELFYQLALEEVLASDSRVKA
AGDIRIGEAILIVDSDTRVPVDCLLYGAAEMFLNPEVAIIQHSTGVMQVSEDYFENGITF
FTNLIYSAIRFAVGSGETAPFVGHNAFLRWQAVQSVGKQDDGYVAYWSESHVSEDFDIAL
RLQIAGNIVRLASYHGDEFKEGVSLTIYDELARWEKYAYGCNELVFNPIYTWIYKGPFTR
LFMTFLWCNLQLSSKITILGYISSYYALASGFPLTVMNYFLVGWLNGSLDKFYLESWKVF
LGLILVFPLLGNICLAIIRYRLAEKSLWGALLENFKWAPMMAIFFGGISFHISLAILSQM
FRVNMEWGATAKEKVDSNFFKEMPKIFKSFKWMYAVVLPLIGGMVYLGCFAPRGWEITEI
AAVVPLSVTLASHALLPLLLNPSLMIFNY

Enzyme Prediction     

No EC number prediction in CIMG_07841-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	550	760	4.6e-55	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	5.26e-53	550	762	2	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	2.10e-10	547	853	138	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	3.72e-09	547	655	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224137	GT2	6.45e-04	548	744	86	283	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18667.1|GT0	0.0	23	929	25	919
CAE7220538.1|GT0	0.0	33	929	34	907
QRD03074.1|GT0	0.0	55	929	3	858
CBX97842.1|GT0	0.0	49	929	47	904
CAC28725.2|GT0	0.0	57	929	142	1003

PDB Hits     

CIMG_07841-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CIMG_07841-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

Start	End
282	304
316	338
745	767
780	802
817	837
873	895
900	922