CAZyme Information: CIHG_09018-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIHG_09018-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
179		19805.27	4.9260

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisH538-4	10724	396776	186	10538

• Gene Location: location=DS017033:8258-8915(+)

Full Sequence      

MSIKSDRLLVHYTTHPAIDEDGDVIRNATAIVSVEGNDPANWFQRHRFDWSKEELRFYHN
GSLMHANNIRIPDVGGRALLNLWADGGIWSGAPSTTNVYMRVKYVIVYHNTTASDSGQDV
EFNDRCARAGGPSNETVCLDVFVEDGAVDPSSIGTALAPLPFWVLSLLWLVLGVIFTSL

Enzyme Prediction     

No EC number prediction in CIHG_09018-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	6	105	1.7e-20	0.46296296296296297

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.72e-15	5	108	108	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	2.50e-05	36	105	133	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185693	GH16_laminarinase_like	0.002	27	108	144	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS61966.1|GH16	1.15e-73	4	168	24	188
QRW14348.1|GH16	4.62e-17	10	138	156	277
QRV85770.1|GH16	4.62e-17	10	138	156	277
QRV99836.1|GH16	4.62e-17	10	138	156	277
EAA58218.1|GH16_22	3.95e-15	10	112	189	292

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GBG_A	5.19e-08	25	105	127	209	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
3O5S_A	5.53e-07	36	105	161	233	Crystal Structure of the endo-beta-1,3-1,4 glucanase from Bacillus subtilis (strain 168) [Bacillus subtilis]
1AJK_A	3.07e-06	36	112	54	133	Circularly Permuted (1-3,1-4)-Beta-D-Glucan 4- Glucanohydrolase Cpa16m-84 [Paenibacillus macerans],1AJK_B Circularly Permuted (1-3,1-4)-Beta-D-Glucan 4- Glucanohydrolase Cpa16m-84 [Paenibacillus macerans]
1AJO_A	3.07e-06	36	112	11	90	Circularly Permuted (1-3,1-4)-Beta-D-Glucan 4- Glucanohydrolase Cpa16m-127 [Paenibacillus macerans],1AJO_B Circularly Permuted (1-3,1-4)-Beta-D-Glucan 4- Glucanohydrolase Cpa16m-127 [Paenibacillus macerans]
1CPM_A	3.07e-06	36	112	79	158	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27051|GUB_BACLI	6.19e-07	25	108	156	240	Beta-glucanase OS=Bacillus licheniformis OX=1402 GN=bg1 PE=1 SV=1
sp|P07980|GUB_BACAM	2.86e-06	36	97	162	225	Beta-glucanase OS=Bacillus amyloliquefaciens OX=1390 GN=bglA PE=3 SV=1
sp|P04957|GUB_BACSU	2.91e-06	36	105	165	237	Beta-glucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=bglS PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

Start	End
154	176