CAZyme Information: CIHG_08401-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIHG_08401-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		49794.87	6.5530

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisH538-4	10724	396776	186	10538

• Gene Location: location=DS017022:158070-159664(+)

Full Sequence      

MAIYNWFGRWRCWVFILSPIPFIILLHQLLTYHDLLQHPFIKNAPKITESGCDAVPGMED
ILVVMKTGVTEALEKVPIHLETTLSCVPHFAIFSDFEEDISGVQTYDVLRTVSKDVKRFN
PDFELYNRIKKLGRDGLRPSDLMMDDVSGPSGKPNNPGWKLDKWKFIPMIDEALEVRPDA
KWFVFMEADTYIVWQNLLAWLERFDPSKPYYLGTEMLLGNILFGYGGSGFVISNSAMEKF
SQYRASRATQLEDYTAHQWAGDGILGKAMADAGIPLTKSWPMLQTARVWDLNHFAEPWCY
PVVSYHHMTPSDVEIMWRFSQQWFKNNTSSILLHQDVFTRLIQPGLSSPRDNWDNFSEEE
HNVPSEDQCKALCVDNSACLQYSHRSDSTPRRWGHARNLNGFVDKIKKAAVVHMWMSGVN
TSHKSEQKRNFV

Enzyme Prediction     

No EC number prediction in CIHG_08401-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	1.14e-05	178	312	209	346	hypothetical protein; Provisional
367085	Fringe	3.59e-04	178	233	83	152	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE61153.1|GT31	2.84e-136	45	386	50	397
UDD60864.1|GT31	2.84e-136	8	386	4	397
QRD90967.1|GT31	1.14e-135	45	386	50	397
QMW31901.1|GT31	4.79e-135	45	386	50	397
QMW43934.1|GT31	6.79e-135	45	386	50	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	6.11e-06	141	240	66	163	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NS00|C1GLT_HUMAN	3.77e-06	164	240	145	223	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1
sp|Q0VC84|C1GLT_BOVIN	3.83e-06	159	311	145	314	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q18515|C1GLT_CAEEL	7.12e-06	159	321	161	308	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=C38H2.2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999974	0.000032

TMHMM  Annotations     

Start	End
13	32