CAZyme Information: CIHG_08253-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIHG_08253-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		24823.77	8.6783

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisH538-4	10724	396776	186	10538

• Gene Location: location=DS017023:3638-4540(+)

Full Sequence      

MALGRKVPSNVKDLYNYAKNHRCRKPLSSSFQDGHGRKGFVYCGDRLDSQGIIYITGPSN
SRGLADMDVDCDGANRSAGDCKNDPSGQDQTAFKDEVKKYGIPDLDSNKHGYVVLGNEGS
SPSFNPAEYGIKPLSVVAVVCNNRLFYGVWGDTNGGTLVGETSVSLAQACFPKEGLNGDN
GHEKHDVLYIAFKGNAAKPGAKGANWKAKNFAGFEKSLEHIGNKLVKKVST

Enzyme Prediction     

EC	3.2.1.132:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	3	227	9.8e-76	0.9363636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	2.12e-99	67	228	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI17114.1|GH75	6.17e-88	7	226	21	230
QGI66296.1|GH75	7.14e-87	7	229	21	233
QGI97180.1|GH75	7.14e-87	7	229	21	233
QGI83540.1|GH75	2.89e-86	7	229	21	233
ABY77913.1|GH75|3.2.1.132	4.53e-86	7	226	3	212

PDB Hits     

CIHG_08253-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	4.85e-89	7	230	21	241	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	9.06e-82	7	226	20	236	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	3.39e-80	7	226	20	240	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	3.39e-80	7	226	20	240	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q875I9|CSN_ASPFM	7.70e-80	7	226	20	233	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CIHG_08253-t26_1-p1.