CAZyme Information: CIHG_08158-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIHG_08158-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	DS017021|CGC3	60222.57	6.4325

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisH538-4	10724	396776	186	10538

• Gene Location: location=DS017021:19381-21244(+)

Full Sequence      

MPAKTTTELPVGDVDSYDYVIVGGGTAGCVIASRLAEYLPRMKILLVEGGPSDFMDDRVL
LLKDWLNLLGGELDYDYGTTEQPMGNSHIRHSRAKVLGGCSSHNTLISFRPFEYDCKRWE
SKGCTGWSFETFSRVLDNLRNTVQPVHARHRNQLCKDWVNACSSTFDIPVIEDFNKEIRS
TGKLTEGVGFFSVSYNPDDGRRSSASVAYIHPMLRGEEHKPNLTVLTDVWVSRVNVSGDT
VTGVNVTLQSGTKLTLRPKRETIICAGAVDTPRLLLLSGLGPREQLSSLNIPVVKDIPGV
GENLIDHPESIIIWELNQPVPPNQTTMDSDAGIFLRREPPNARDFDGDAADVMMHCYQIP
FCLNTARLGYDTPTNAFCMTPNIPRPRSRGRLYLTSSDPNVKPALDFRYFTDPEGYDAAT
IVYGLKMARKVAQQSPFKEWIKREVAPGPNLTTDEELSEYGRRVAHTVYHPAGTTKMGDV
TRDPMAVVDPQLKLRGLKNVRIADAGVFPDMPTINPMLTVLAIGERAAELIAQEAGWKGA
APRL

Enzyme Prediction     

No EC number prediction in CIHG_08158-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	538	1.3e-89	0.5129449838187702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.85e-108	16	536	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.30e-105	16	531	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.29e-42	386	527	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.19e-34	2	524	41	569	Protein HOTHEAD
366272	GMC_oxred_N	3.17e-24	93	309	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS03844.1|AA3_2	0.0	5	544	92	631
BCS15458.1|AA3_2	0.0	5	544	3	542
CAK47101.1|AA3_2	0.0	5	544	3	542
EAA64559.1|AA3_2	0.0	5	544	3	542
ATQ35968.1|AA3_2	0.0	5	544	3	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	9.65e-122	17	531	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.36e-121	17	531	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	3.84e-121	17	531	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	3.42e-53	17	542	84	649	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	5.33e-53	17	542	8	573	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	4.97e-121	17	531	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	1.39e-72	15	532	5	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q8NUM0|BETA_STAAW	8.09e-68	16	531	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=betA PE=3 SV=1
sp|Q6G664|BETA_STAAS	8.09e-68	16	531	7	536	Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=betA PE=3 SV=1
sp|Q4L9D7|BETA_STAHJ	1.10e-67	15	531	5	534	Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000006

TMHMM  Annotations     

There is no transmembrane helices in CIHG_08158-t26_1-p1.