CAZyme Information: CIHG_07550-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIHG_07550-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: Cap3p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613	DS017016|CGC1	70276.54	9.3873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisH538-4	10724	396776	186	10538

• Gene Location: location=DS017016:63529-65525(-)

Full Sequence      

MGTEWFQPMNRKGSLEAALGMRFHRVLALLGLAVLVWISLSLIRTKSAAPVIPASGSTPK
HDEPLRPASPPSPADKKTHPIARLINQSKSSWDGVRSRQSKTLKEAVEEYRRRYKLSPPP
NFDVWFEFAQSKGVELIDEYDTIYHSLLPFWSLQPKTIRDRVKESLGFDNALIGVLIRDG
KISLVDGGGNSQQWKRDALTGMMQRFIRYLPNMDLAFNTHDEPRVVLPSDDLQRLVSNAL
DTVIPKVAKHPVDNSWTSPTDLNKGDRINETKTTRFNWFAHQATWTTSRSSCPIDTPVRD
LNENARDKIEAYLSGDLGFIYNTTAFSDICLSPSLRYAFGMFERPNAMSVVRDLFPIFSE
SKVSSFQDILYPSPWYWSGKVTYDPKLDVSWDNKKSQVYWRGSTTGGFSRAGGWRRQHRQ
LFVKNINAVDDVKVLENKEGNWTMHTVKQNTFTHLLNVSFSHVGQCDPEDCNAQSHYFNI
VKPDSQHEAWRFKYLADVDGNAFSGRFYALLKSNSLVYKLAVFREWHTEWIQPWVHYVPL
SLRGNEHIEAIRYFASEEEGQRHAKFIAQGSSSWAKKALKNDALEVWFFRLLLEYGRIVD
DNREKIGFSFGSS

Enzyme Prediction     

No EC number prediction in CIHG_07550-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	333	599	1.4e-77	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.85e-17	356	597	32	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	6.49e-06	339	597	96	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE54850.1|GT90	5.71e-266	21	609	1	608
CAP94438.1|GT90	5.08e-265	21	608	1	590
UCK57446.1|GT90	9.45e-265	20	609	8	618
BCR83603.1|GT90	3.17e-263	21	608	1	598
QSS70518.1|GT90	1.23e-261	20	609	6	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	4.12e-08	333	602	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	5.70e-06	356	599	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.10e-55	78	604	151	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	2.41e-07	333	602	123	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	3.20e-07	333	602	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	5.62e-07	333	602	123	373	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|Q7ZVE6|PLGT2_DANRE	9.33e-07	474	598	343	465	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000005

TMHMM  Annotations     

Start	End
21	43