CAZyme Information: CIHG_02164-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIHG_02164-t26_1-p1
• CAZy Family: CE9
• CAZyme Description: glyoxal oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648	DS016985|CGC3	71407.99	5.7424

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisH538-4	10724	396776	186	10538

• Gene Location: location=DS016985:232371-234421(-)

Full Sequence      

MFAGFREKIQQGLASPHEICMELINSTDPIFEDMFPSNEQPVDEPLLRPAPPKTPAGDSD
GSTLVTNNGHCGSAHKNMVCGDWPKGSCCSPFGICGNTTSHCGYGCQSGACLSEDALKPP
ALIRFRPSRLPGQFHIIGRSGVPPMIAVLLQNGRVAFADKVENYTEVVLENGRYAYSTEF
DPITSSLAPLSYKTNVFCSGGTFLADGRVLSVGGNGPLKWMDPTVDDGFRGIRYLERRFD
DDNFDGTPWEEPGHQLSTGRWYPTVQTLSDGRVFVVSGSLNGDDPSVMRNNNPTYELLDK
NGFPSGNSVELSILDENQPYYMYPFLHLLNDGTVFIFVSRSAEVFDVDAGVTVKTLPDLP
GDYRTYPNTGGSVLLPLRSANGWEPEIIICGGGAFQDIDSPSDPTCGRIRPLSEEPRWEL
EAMPGGRIMGEGILLPDGTVIWINGCRNGAQGYGIAENPIYNPWIYRPQAPPKKRWAIGG
TSEVPRMYHSVALLLLDGTVLVAGSNPVEQPLLVTNPNDPMLAFPTEFRVEIYTPHYFMD
GKADRRPRKIVISSRYLEPDGNFDITFHNRRPARKLSIVLYHGGFVTHSVHMGHRMLYLD
HQGWKSWRKKQKVSVKMPPTSSVVPPGPYVIYVLVDGIPGEGQFVMVA

Enzyme Prediction     

No EC number prediction in CIHG_02164-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	130	647	3e-147	0.9502664298401421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399910	Glyoxal_oxid_N	3.83e-53	145	392	1	243	Glyoxal oxidase N-terminus. This family represents the N-terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes. Glyoxal oxidase catalyzes the oxidation of aldehydes to carboxylic acids, coupled with reduction of dioxygen to hydrogen peroxide. It is an essential component of the extracellular lignin degradation pathways of the wood-rot fungus Phanerochaete chrysosporium.
401164	DUF1929	1.44e-27	552	647	1	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	2.59e-19	541	647	1	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
211316	ChtBD1_1	8.13e-13	71	110	2	40	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	1.76e-12	71	108	2	36	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69861.1|AA5|CBM18	1.38e-271	66	647	46	627
QSS64055.1|AA5|CBM18	1.84e-269	66	647	46	627
APA08794.1|AA5|CBM18	2.15e-244	44	647	216	817
CAD89674.1|AA5_1|CBM18	6.70e-244	44	647	55	656
QSZ32349.1|AA5|CBM18	7.32e-244	44	647	211	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UNM_A	2.91e-17	251	647	251	614	Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans],4UNM_B Structure of Galactose Oxidase homologue from Streptomyces lividans [Streptomyces lividans]
6XLT_A	1.17e-15	177	647	205	638	Chain A, Galactose oxidase [Fusarium graminearum]
5LXZ_B	1.43e-15	251	647	240	603	W288A mutant of GlxA from Streptomyces lividans: Cu-bound form [Streptomyces lividans TK24]
5LQI_A	1.44e-15	251	647	245	608	W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326],5LQI_B W288A mutant of GlxA from Streptomyces lividans: apo form [Streptomyces lividans 1326]
2EIC_A	1.52e-15	177	647	204	637	Chain A, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3HRQ2|GLOX_VITPS	1.07e-68	130	645	13	519	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1
sp|Q9FYG4|GLOX1_ARATH	1.83e-58	176	647	157	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|D4AUF1|WSCD1_ARTBC	4.93e-54	76	647	357	903	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|Q01772|GLOX_PHACH	1.40e-53	140	646	35	548	Aldehyde oxidase GLOX OS=Phanerodontia chrysosporium OX=2822231 GN=GLX PE=1 SV=1
sp|A0A2H4HHY6|GLOX_ARTAN	1.31e-45	180	645	132	591	Putative aldehyde oxidase Art an 7 OS=Artemisia annua OX=35608 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CIHG_02164-t26_1-p1.