CAZyme Information: CIHG_01678-t26_1-p1

Basic Information

• Species: Coccidioides immitis
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Coccidioides; Coccidioides immitis
• CAZyme ID: CIHG_01678-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595		65482.83	4.7866

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CimmitisH538-4	10724	396776	186	10538

• Gene Location: location=DS016984:67267-69109(-)

Full Sequence      

MAADKKTIEEFCRRKYDYLIVGGGTAGLVLASRLSEDPFVTVGVLEAGELQLDGPTLRKS
SVGFYPMVEDLNYDWGFQTEPQRHAHGIVYDLPSGKILGGSSVTNHNLFTRGCKTEYDDW
ETLGNPGWNLEGLLPYFSKAEAQQPSKNGNPTFGDAHGSKESEVAKQVVTSTANDIAKGN
TLWHNAWAELGICGGPKQPMETIVSSIAGTRTSSVEAYYLPVMHRGNLHVLTTVLASSVT
FSTKEGSKLIATGVEFLNFDDNYRCEAALEVIICSGAVMSPGILERSGIGSKDVLDEHGI
KTLVHNSRVGENLQDHAYTYSLLELETEEHSLDKNFGKLQIGETSVKESDSSSATGLTLS
TFVTYEHAAMGRVPPPPELILDAIRRTPLLRKQYDLTLRRLHDPNVACFQYQFVPGYASS
LLPEPTPDDANNFVAILYSISTPFSRGAIHIESSDPRDYPTVDPSYLEHPLDMRLLRAAT
RMSLDLICTGALSSVTYDIVVPYQPMITEQNYDEHACETCESYFHPVGTCAMMPREDGGV
VDPNLIVYGTENLRVVDSSIIPLHISGDIEWTVYAIAEKAADMIKDQRHMIQKII

Enzyme Prediction     

No EC number prediction in CIHG_01678-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	15	586	6.8e-144	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.39e-94	14	585	4	532	choline dehydrogenase; Validated
225186	BetA	4.56e-87	14	585	6	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.01e-37	443	580	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.63e-25	92	316	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.16e-18	16	560	56	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW06477.1|AA3_2	3.72e-104	10	585	8	598
QRV77531.1|AA3_2	3.72e-104	10	585	8	598
QRW08161.1|AA3_2	3.72e-104	10	585	8	598
QRV79276.1|AA3_2	3.72e-104	10	585	8	598
QRW21584.1|AA3_2	1.49e-99	9	585	7	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.29e-72	16	586	6	566	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	4.06e-57	16	585	17	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
6ZE2_A	5.63e-55	16	590	6	588	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	6.12e-54	16	585	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.14e-53	16	585	3	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	6.06e-78	7	584	5	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	8.66e-78	10	585	8	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	8.66e-78	10	585	8	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	9.56e-72	14	584	45	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	9.56e-72	14	584	45	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000004

TMHMM  Annotations     

There is no transmembrane helices in CIHG_01678-t26_1-p1.