CAZyme Information: CGB_K4500C-t26_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: CGB_K4500C-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848	CP000296|CGC4	93845.36	6.0829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiWM276	6580	367775	15	6565

• Gene Location: location=CP000296:1002646-1005495(-)

Full Sequence      

MSNQAMDRSFLTASVEELVSMMSLGEKVSLLAGEDWWRVKVTDGPNGARGESFFDMTPAT
VLPNATALAATFSPTLPGEAARLLAKETKARSAVCLLAPTVNICRSPLGGRAFESFSEDP
TLSGILAAKYINGLQSEGISATLKHFIANDQEHERMGQDAIIGERALREVYLRPFHIAQA
RADPWSYMTSYNKLNGTHCAEHPWLLKDLLRKEWGFDGLVMSDWMGTYSVSEAINAGLDL
EMPGKARWRQLQLVRQMVNAHKILPATIDERVINLLRWVQKMATLNPDIVYERDDRKEWT
RNEDREADAALVRKIGNEAIVLLKNENAVLPIKRGKVAVIGPNAKNSVITGGGSARLRPS
WRVTPWEGLVNNKPDDIELSYALGCKGSKFLPIFGPEFTSMDGETPGSFDLLHYAIDASG
KQAAKPAVSQVWHNSDIMLADFRHPDLGEDYFTEVHALFTAPITGHWDFEVSVTGQAWVY
MDDRLVADLSKEQKRTSSFFGNGGNGTVFTVAVEKGKFRLVHDSRKPPLAPGQDSQPLQL
IGMKLGSFPSISEDTTIDEAVALAKESDTVVLVVGLDHDWESESYDRPNLSLPLRLNELV
HRVATEAPNTNKVVVLQTGSAVSMPWREHVDSVVWPWYGGNEAGNAIADIIYGTANPSGR
LPLTLPERELDIAANLNFRSARTKTYYEEGIWVGYRHFNARGIKPMYPFGHGLSYTEFDY
SDLQVVSSPSNTPNDWRIRVSAKVTNTGKVAGAHSVHFYVTPPPPTSNSLLHPEVTLQGF
TKTGILPPGGSEKVSIEMDKFAISHWDELTSIWRAESGQWLVRIGRDAQTMCLQAPFEVP
SGFKWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	42	243	9.8e-61	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.74e-75	60	838	118	763	beta-glucosidase BglX.
224389	BglX	4.58e-64	59	356	80	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.09e-50	11	799	49	743	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.49e-46	320	715	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	9.26e-41	59	277	85	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV25063.1|GH3	0.0	1	848	1	848
KGB78164.2|GH3	0.0	1	848	1	862
AUB23806.1|GH3	0.0	1	848	1	862
AFR94189.2|GH3	0.0	1	848	1	862
QKD55271.1|GH3	0.0	1	848	1	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.26e-176	15	848	6	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.46e-172	15	848	6	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.72e-115	11	844	1	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	4.39e-92	15	839	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	4.46e-91	19	835	9	659	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y3M6|BGLI_ASPFC	4.95e-198	15	848	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	4.95e-198	15	848	6	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.44e-197	15	848	6	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.10e-196	15	848	6	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.14e-196	15	848	6	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000004

TMHMM  Annotations     

There is no transmembrane helices in CGB_K4500C-t26_1-p1.