CAZyme Information: CGB_J1490W-t26_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: CGB_J1490W-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: glucan 1,3-beta-glucosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	CP000295|CGC2	47261.15	4.4753

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiWM276	6580	367775	15	6565

• Gene Location: location=CP000295:304843-306795(+)

Full Sequence      

MVKLSPCAFLISHVFNKRTTLAPGFTWGTDPMRGVNIGGWLVLEPWITPSIFEGKPDWVV
DEWTYGVYMNNRTDTMVEIRNHWNTWFSYTELQNIAAVGLNTIRIQIGFWSVIPLENGEP
YLVGAYDYLKLAVTWASSLNLKMMVDVHGCPGGQNGFDNSGIRGVREWFTNDTNISRTLS
AIQVLTAEFSQSFYNNTVIAIELINEPFPYTNAELDILKSYYEAGYGTVRSNDRASKLVV
AIDEGFQGLQTWEAFMQGSNYSNIAMNTRIYTMFDTDLITMGYSESLDWYCGQKDYLVTS
NNVHWTIVGEFVPANTDCAYWLNGRGMGARYDNTLNTSALRYPGDCGDKTGADPSKFSAE
YIEYLAKSFETQTWVYEQASGWVMWTWKTELAADWSMQTGITYAGWIPTPIYSKTHG

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	81	390	1e-97	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.63e-30	29	416	15	390	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.63e-06	92	233	30	158	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV24619.1|GH5_9	0.0	1	417	1	417
AAW43031.2|GH5_9	1.82e-262	1	417	1	427
AFR95190.1|GH5_9	1.83e-261	16	417	3	411
AUB24953.1|GH5_9	1.83e-261	16	417	3	411
UOH81096.1|GH5_9	8.06e-238	16	403	3	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	5.86e-66	32	414	9	385	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.16e-65	32	414	9	385	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.36e-65	32	414	15	391	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1H4P_A	2.36e-65	30	416	11	399	Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
2PC8_A	3.78e-65	32	414	15	391	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	4.88e-84	17	398	27	394	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q96V64|EXG_BLUGR	3.18e-81	25	414	30	410	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|B8N151|EXGA_ASPFN	9.41e-78	22	409	21	394	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	9.41e-78	22	409	21	394	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|Q0CR35|EXGA_ASPTN	3.97e-76	22	416	30	411	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.991390	0.008632

TMHMM  Annotations     

There is no transmembrane helices in CGB_J1490W-t26_1-p1.