CAZyme Information: CGB_G4580C-t26_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: CGB_G4580C-t26_1-p1
• CAZy Family: GH79
• CAZyme Description: endo alpha-1,4 polygalactosaminidase precusor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	CP000292|CGC7	37893.46	3.8111

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiWM276	6580	367775	15	6565

• Gene Location: location=CP000292:897312-898784(-)

Full Sequence      

MILISLSSWFLVISSLVAATAAKPYPRNVHHQHCGLSSSVTMVETSVDATSPEETASTVN
SLNTETALASATNSNNAATASSISTVTSVSLSSTFIYELDAQSVTSPEVTADTGLVVNAG
VYIVDSEGTSEDTIAQYHADGKTVICYFSAGTWEPGRSDADKFDPACVCGPGGSFAGDAC
SSNDNKLSGWNEWWLDIHSASCISNVESIMSARISSFMAKGCDGVDPDNVDSFANSDQLH
GNTADDQVNYLLWLSSTARSQGLMIDLKNAGSLLVDDNGDATSYQSEIIEAFDFAVIESC
HEYEECNTYDSFLAAGKPEIQIEYGDITTCPSLQDGQHLLVYSQNSLSSALITLECD

Enzyme Prediction     

No EC number prediction in CGB_G4580C-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	116	324	3e-65	0.9368421052631579

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	1.61e-69	97	324	4	191	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	5.13e-13	117	324	76	266	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV23543.1|GH114	7.02e-244	1	357	1	357
KGB76338.2|GH114	6.91e-224	1	357	1	359
ALO69276.1|GH114	1.02e-202	1	357	1	359
AAW44548.2|GH114	1.58e-202	1	357	13	371
AFR96657.1|GH114	1.98e-202	1	357	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	1.59e-29	117	328	55	238	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	2.27e-29	117	328	72	255	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

CGB_G4580C-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000677	0.999310	CS pos: 21-22. Pr: 0.9602

TMHMM  Annotations     

There is no transmembrane helices in CGB_G4580C-t26_1-p1.