CAZyme Information: CGB_E4340C-t26_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: CGB_E4340C-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		33863.17	4.5721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiWM276	6580	367775	15	6565

• Gene Location: location=CP000290:852440-853519(-)

Full Sequence      

MAGFTGDGTLISSYYNWSPYPVIPSSRHSSLYDVPFTFVPMLWGCNSTYIEPFLKQVANN
FSDVVLTPKRDILGFNEPNQIGQAECSPEEAAQTWIEVIEPLKLQGYRLGSPAVTSGDSG
KEWMARWYEACNGSCNPDFTAVHWYDLVAQNFIEHIQYCHSIYGKNIWVTEFAPQNFSVN
NMTTGTYVGQATYVEIQRFMDVVTSYMKSVSWVERWFWFGAMYDMQGVNPLDTLFAESGK
QGRTGALNELGVQYAGSNGSVLLSDQTSWASSTMSEKGYGLQGLFIFWLIVMVSARVLQH
V

Enzyme Prediction     

No EC number prediction in CGB_E4340C-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	7	254	3.7e-71	0.9732142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	4.31e-81	1	254	8	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV22591.1|GH128	3.85e-231	1	301	1	301
AUB25440.1|GH128	1.18e-199	1	301	54	354
AFR95613.2|GH128	1.18e-199	1	301	54	354
AAW43837.2|GH128	1.89e-199	1	301	38	338
UOH82541.1|GH128	4.66e-167	1	240	1	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	2.58e-17	7	175	19	180	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	4.26e-17	7	175	50	211	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UAQ_A	1.56e-16	38	219	66	235	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	4.04e-16	38	219	66	235	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]
6UAX_A	4.12e-16	11	254	115	342	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	2.88e-15	11	247	318	527	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CGB_E4340C-t26_1-p1.