CAZyme Information: CGB_D4210C-t26_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: CGB_D4210C-t26_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		47448.12	6.5057

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiWM276	6580	367775	15	6565

• Gene Location: location=CP000289:943041-944672(-)

Full Sequence      

MTSPAKAYPSRPSFLHYIQNPRHLVRPSIRLKTTLYSLSLIIIILLVLALNAATTPPIHV
PDVAKSPNPDTPADSGEGKDIAQGKDAHLVDGDIQRSFEEPDFALLSGRQPHEIGCDIPL
EGDDKGVLVFLGIFSTAQNKGRRDLYRETIIPDFPPELVTVKFILGLPPYPEHSSSSEVS
KRAKLLKDVTKEMKKHGDMVMLPMIDNIDLGKTHEYFKWVAHEYAGEGRVKERPRFVMKA
DDDTILVMPNMISAFKDLDCATNVYWGTSAGRSHYFGDYFRGLAYAMSWPLVSWIGSANM
THAHITKIEDARTGQWLRHLDPITDPIRRIDMGWTMGDWNQLDVDIKTVALHWCKLDDWV
REQHSRLLQVWSDAGREYTPENGVPPRESIAKGKITPQEAEKEHQRQKELGWDVQGNLE

Enzyme Prediction     

No EC number prediction in CGB_D4210C-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	142	320	1.9e-21	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	1.78e-09	142	332	2	195	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
215596	PLN03133	0.006	124	256	382	498	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV21824.1|GT31	9.55e-317	1	419	1	419
KGB74789.1|GT31	9.72e-312	1	419	1	419
AFR95097.1|GT31	9.57e-303	1	419	1	419
AUB24845.1|GT31	9.57e-303	1	419	1	419
AAW42947.1|GT31	2.52e-298	1	419	1	419

PDB Hits     

CGB_D4210C-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USX0|PVG3_SCHPO	1.23e-07	123	272	60	242	Beta-1,3-galactosyltransferase pvg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pvg3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999956	0.000049

TMHMM  Annotations     

Start	End
35	57