CAZyme Information: CGB_C2450C-t26_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: CGB_C2450C-t26_1-p1
• CAZy Family: GH105
• CAZyme Description: glicosidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
875	CP000288|CGC6	97984.26	6.0385

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiWM276	6580	367775	15	6565

• Gene Location: location=CP000288:508827-511758(-)

Full Sequence      

MPIVERELSGFQLITSPSIGDSIASFSLVSSPESIYKNFTYRISFPLPNVYRILLTGPDR
TRPLQDNVALAPSESKFNVIALDTAECEATFDFPSPTSESLDGAERRRRQLHLSWKEHIT
LTTYETFLSTGQQFRLLGDLPNRSYALTEHGVMRHWWVETDNLHLGLGEKAAPLDLSNRS
FMNHGSDSAAYDAYQTDPLYKHTPYLISTPRPRSEGEELPSTYAIYHPTNAGGEWNVRRL
HDDPWGYFKAYTQDYGGLEEWVLVGKGVEQVIRTFAEIVGRPRLVGRDWLGYLASGMGLG
ESDDPPAQELLSRWPELCRKYDIPCSAMHLSSGYTADKDGNRCVFTMNTKRYPDFKGMVA
HFHKAGIKVVPNVKPYVLQTHPHYKDLHSSNALFYDPYSKAPVVTRIWSAGVGDNEKGSW
VDMTSEEGRRWWADGVKSLIDLGVDGMWDDNNEYYLHDDSFVCAASLPHKFTSSPSGPVT
IGEIGRMINTELVNYVSHTTLETAHPTRRTYVLTRSGNVGAFKYANSTWSGDNYTSWHNL
RGSQAIQLNAGMSLMQSYGSDIGGFGGPLPGEEMFVRWVQLGVTHSRFCIHSFKPNQGDL
SGAGATNTPWMYPTVLPIIREAIKWRYEHIPFFNSLMWESHLRATPTTTWLGFGPFASDP
ALYEAAILEGFDAWLGNGRILVCPALFEGQLTREVYFPKACIDDKSLYFDLNAPYKAYKA
GDRVVIATPLEHMGLFAREGAVVPVGKRYHTVTQKQGPARQTPDGVDVVLEGEGGVVGLD
DWRGVKIFPGNEGNVYKGQWTEDDGISAAPDKTVVEVEYVGGNDEVTVEIKLTEHKFKTL
WGRTLAVLLPVGDERSVKNGKEGVWEGRKVWNIEF

Enzyme Prediction     

No EC number prediction in CGB_C2450C-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	261	743	2e-91	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269885	GH31_glycosidase_Aec37	9.87e-143	280	623	1	319	E.coli Aec37-like. Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37. The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
395838	Glyco_hydro_31	2.45e-87	262	743	2	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	6.53e-85	164	788	155	711	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	5.94e-52	319	643	34	338	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
269884	GH31_transferase_CtsZ	3.21e-42	280	639	1	332	CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z)-like. CtsZ is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY. CtsZ and CtsY both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsY belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV20909.1|GH31	0.0	1	875	1	875
KGB78232.3|GH31	0.0	1	875	1	875
UOH80346.1|GH31	0.0	1	875	1	875
AUB27924.1|GH31	0.0	1	875	1	875
AFR97856.1|GH31	0.0	1	875	1	875

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJW_A	2.29e-26	166	870	66	682	Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5DJW_B Crystal structure of Family 31 alpha-glucosidase (BT_3299) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3W37_A	3.28e-25	256	801	288	811	Sugar beet alpha-glucosidase with acarbose [Beta vulgaris],3W38_A Sugar beet alpha-glucosidase [Beta vulgaris],3WEL_A Sugar beet alpha-glucosidase with acarviosyl-maltotriose [Beta vulgaris],3WEM_A Sugar beet alpha-glucosidase with acarviosyl-maltotetraose [Beta vulgaris],3WEN_A Sugar beet alpha-glucosidase with acarviosyl-maltopentaose [Beta vulgaris],3WEO_A Sugar beet alpha-glucosidase with acarviosyl-maltohexaose [Beta vulgaris]
2QLY_A	1.60e-21	250	771	252	759	Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase [Homo sapiens],2QMJ_A Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase in Complex with Acarbose [Homo sapiens],3CTT_A Crystal complex of N-terminal Human Maltase-Glucoamylase with Casuarine [Homo sapiens]
3L4T_A	1.61e-21	250	771	252	759	Crystal complex of N-terminal Human Maltase-Glucoamylase with BJ2661 [Homo sapiens],3L4U_A Crystal complex of N-terminal Human Maltase-Glucoamylase with de-O-sulfonated kotalanol [Homo sapiens],3L4V_A Crystal complex of N-terminal Human Maltase-Glucoamylase with kotalanol [Homo sapiens],3L4W_A Crystal complex of N-terminal Human Maltase-Glucoamylase with miglitol [Homo sapiens],3L4X_A Crystal complex of N-terminal Human Maltase-Glucoamylase with NR4-8 [Homo sapiens],3L4Y_A Crystal complex of N-terminal Human Maltase-Glucoamylase with NR4-8II [Homo sapiens],3L4Z_A Crystal complex of N-terminal Human Maltase-Glucoamylase with Salacinol [Homo sapiens]
3LPO_A	1.96e-20	250	846	280	841	Crystal structure of the N-terminal domain of sucrase-isomaltase [Homo sapiens],3LPO_B Crystal structure of the N-terminal domain of sucrase-isomaltase [Homo sapiens],3LPO_C Crystal structure of the N-terminal domain of sucrase-isomaltase [Homo sapiens],3LPO_D Crystal structure of the N-terminal domain of sucrase-isomaltase [Homo sapiens],3LPP_A Crystal complex of N-terminal sucrase-isomaltase with kotalanol [Homo sapiens],3LPP_B Crystal complex of N-terminal sucrase-isomaltase with kotalanol [Homo sapiens],3LPP_C Crystal complex of N-terminal sucrase-isomaltase with kotalanol [Homo sapiens],3LPP_D Crystal complex of N-terminal sucrase-isomaltase with kotalanol [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9F234|AGL2_BACTQ	5.46e-39	159	746	145	677	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|O04931|AGLU_BETVU	3.22e-25	256	801	288	811	Alpha-glucosidase OS=Beta vulgaris OX=161934 PE=1 SV=1
sp|P07768|SUIS_RABIT	1.78e-23	256	782	319	832	Sucrase-isomaltase, intestinal OS=Oryctolagus cuniculus OX=9986 GN=SI PE=1 SV=3
sp|P79403|GANAB_PIG	1.30e-21	129	792	243	859	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q8BVW0|GANC_MOUSE	2.15e-21	187	792	236	812	Neutral alpha-glucosidase C OS=Mus musculus OX=10090 GN=Ganc PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999858	0.000155

TMHMM  Annotations     

There is no transmembrane helices in CGB_C2450C-t26_1-p1.