CAZyme Information: CGB_B9530C-t26_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: CGB_B9530C-t26_1-p1
• CAZy Family: CE9
• CAZyme Description: putative alpha-1,2-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	CP000287|CGC2	59682.99	4.8831

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiWM276	6580	367775	15	6565

• Gene Location: location=CP000287:2116311-2118077(-)

Full Sequence      

MLRRNYTPTPLGYAVLTFFALITLYFLTPADSSISLLPSPWSSQSDKWATPHESTEEEED
ESDRQPLPLLPEIYASEFPGLKLPRSLRASPKFYALNSRLVSLLSRPVLSHSAASQANLE
GCPSELSDKLVNPDQYAGDGWFWRDEVDEAEIVRRRADVVRYLSEAVERGEQVLGQEGET
GKGRGIVLTGGNQDTTLRTITAIKHLRRLGVDLPIEVFHYSDELHDKEQRKEIESLGATL
REAKGLEKVAGVWKNWQIKGLALVQSSFREILYLDSDNTPLRSPSHLFDAPIYTSSGRAA
FWPDLSKDHPDNAIWRLVGETCSLDLWTFESGQIVVDKAGNDGMNLAALIVAAGMMRDRD
FWFHMCGGDKDTFRWAWRMLNIDFGVSPRWMSTVGIRNTFQNERFCGHSVLQYDLATPEG
FSRPPPLFVHSNLLKHLGGARLSKGDLFKFVRRMSEDYSSSPLLNHAHSFVYDGTARGMC
LDLNWHEDTPQEVKEDVSVETYAVEQEEGGVFDGFEDAWWEEGGRVGGW

Enzyme Prediction     

No EC number prediction in CGB_B9530C-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	183	414	1.7e-56	0.9962121212121212

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	4.44e-28	183	414	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	0.002	206	305	23	127	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV20672.1|GT71	0.0	1	529	1	529
KGB80352.1|GT71	0.0	1	529	1	529
AAW41452.1|GT71	0.0	1	529	1	529
AUB22503.1|GT71	0.0	1	529	1	529
AFR93017.1|GT71	0.0	1	529	1	529

PDB Hits     

CGB_B9530C-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A687|MNN22_CANAL	1.93e-10	158	304	136	288	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
sp|P38069|MNN2_YEAST	3.18e-09	180	420	167	446	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q59WF4|MNN2_CANAL	1.28e-08	176	304	178	310	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2
sp|Q5AD72|MNN24_CANAL	5.63e-08	182	319	291	429	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
sp|Q5AP90|MNN23_CANAL	6.84e-08	184	307	174	302	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.404181	0.595806	CS pos: 32-33. Pr: 0.5561

TMHMM  Annotations     

Start	End
7	29