CAZyme Information: CGB_A9620C-t26_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: CGB_A9620C-t26_1-p1
• CAZy Family: CBM48
• CAZyme Description: glycosyl hydrolase family 88 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	CP000286|CGC12	50666.24	5.1409

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiWM276	6580	367775	15	6565

• Gene Location: location=CP000286:1962588-1964223(-)

Full Sequence      

MTMATNNTAEEILSVQAKAQLDSEKPQASSVPSSPLKLELDSDKATKLINLLTDGLVSIR
DEDGRFLLKLDDGTLIDTKGWEHPTVFSWEWTHGIALTALCHHSAISRTSPASQKSLDTA
MTWFNSQYSRTSGKGAPKNINTFSPFYALASFLEDGREMDEQGKWRAWCEDWGEWVMRDD
GLPKTQEGGFQHITYANAHPQNLWDDTLMMSAIPLAKLGILLNQPSWIDEAVYQFLLHIR
YLSDPVTGLWYHGWEFTPDKRGRAAEQEGGQGWKGGKNGHNFARAFWARGNCWITLAIPM
LLSILSPSSSSPHPKPLHPTDPTARFLIQTWTRQVDALIALQDPNSGMWHTLLDDPESYV
ETSASAGFVAGIYMGLRMNLIPPSKSISYRAAADAALAAILTQIQPDGQVANVSFGTGMG
ETLQFYRDIAITPMPYGQALVMHALVEWERLNEVGE

Enzyme Prediction     

No EC number prediction in CGB_A9620C-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	78	450	1.3e-111	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.46e-76	56	451	8	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.03e-63	59	451	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV19987.1|GH105	0.0	1	456	1	456
KGB75254.1|GH105	0.0	1	456	1	456
AUB22466.1|GH105	0.0	3	454	1	452
AFR92981.1|GH105	0.0	3	454	1	452
AAW41249.1|GH105	0.0	1	456	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	8.09e-95	49	450	12	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	2.92e-94	43	450	24	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	4.78e-93	48	450	30	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4WU0_A	1.08e-13	180	384	107	286	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.96e-09	194	451	188	413	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	8.54e-30	87	447	27	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CGB_A9620C-t26_1-p1.