CAZyme Information: CGB_A9170W-t26_1-p1

Basic Information

• Species: Cryptococcus gattii VGI
• Lineage: Arthropoda; Insecta; ; Eriococcidae; Cryptococcus; Cryptococcus gattii VGI
• CAZyme ID: CGB_A9170W-t26_1-p1
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876	CP000286|CGC7	94045.14	3.9802

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CgattiiWM276	6580	367775	15	6565

• Gene Location: location=CP000286:1842206-1844995(+)

Full Sequence      

MSAFTYTAALFSLISLLPSALAGPTAGTTYSISPNQHPSMCLGPAHDWEGADVVIKDCDE
DDTTWLWTGQSFQNTATQLCIDIRDAGAWSGNKAQVWGCFPYNTNQQFNVEGSMIHWEDF
CWDLTDGSSSAGTKLQIWSCFSYNDNQQWTFTEIEEVDECDATSVTETATIMSTATASNS
DLSSTTASASASNIPEAVSAAESLTASLNASDPFFTASATGSGYEANATASATESAYGSL
NGTASATYSSYDVNATASATYSSYDVNATASATDSGYESINATASATESGYEFVNATASD
TLSASDTLSAETSTATNSSIGEGLWSPHKSSSVSSDEWSSETTTDSSTEWWATSTGSNSW
ASATASASNPWQSASGSGAWNSTSTASNSWETASQSDSWNVTSTASNSWETASQSDSWNV
TSTASNSWETASSQAWNETSTDSWGGSATATATTSDSYGSATSTSTSSAISATATVGTIS
SGYLQTSGTKIVDSDGNEVILRGTNIGGWLVLEDWMCGISDESGSADRFSLTTLENRFGT
EQARTLVEAWAENWLTTADFDELANIGFNVIRLPFSFRTVQNADGSWRDDAFTRMDWAIA
QAKARGIYVIVDFHMWPGQEADYSAISENTDEGQSQRNAVGEIWKKVATHYLGESSICAF
DVINEPTGSYGDYLQQDLYNAVRSVDASRIIIHESISTNPSTYGWTNVIYSLHEYDMMGS
DFDSNKATWANGVQAYIDLWHGYNIPFMLAEFMADGDTLDYMLNSLNSQGLSWLTWAHST
VNMGRWGIWNHQPFYVDVSSDSYDTIYNTWTNMPSTFHTYIYDQLKSAATGSISVSRKRD
LAPGARTTKRLHGSHGGRSRRNGVVHAVKGAAAVSI

Enzyme Prediction     

No EC number prediction in CGB_A9170W-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	533	777	3.5e-54	0.9885931558935361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	3.78e-21	556	777	26	267	Cellulase (glycosyl hydrolase family 5).
395527	Ricin_B_lectin	1.31e-15	35	149	7	126	Ricin-type beta-trefoil lectin domain.
225344	BglC	9.15e-13	553	716	72	243	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	4.11e-10	72	153	5	86	Ricin-type beta-trefoil lectin domain.
238092	RICIN	4.16e-09	38	151	9	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV19959.1|CBM13|GH5	0.0	1	876	1	876
KGB75297.3|CBM13|GH5	0.0	1	876	1	909
UOH79756.1|CBM13|GH5	0.0	1	876	1	789
AAW41305.1|CBM13|GH5	0.0	1	876	1	847
AFR92930.1|CBM13|GH5	0.0	1	876	1	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	7.52e-15	493	717	8	256	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1EQP_A	1.29e-14	493	725	3	260	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PF0_A	1.34e-14	493	725	9	266	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	1.72e-14	493	725	3	260	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
4M80_A	1.78e-14	493	725	8	265	The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans at 1.85A resolution [Candida albicans SC5314],4M81_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with 1-fluoro-alpha-D-glucopyranoside (donor) and p-nitrophenyl beta-D-glucopyranoside (acceptor) at 1.86A resolution [Candida albicans SC5314],4M82_A The structure of E292S glycosynthase variant of exo-1,3-beta-glucanase from Candida albicans complexed with p-nitrophenyl-gentiobioside (product) at 1.6A resolution [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	2.84e-25	483	781	3	340	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A1CRV0|EXGA_ASPCL	4.13e-20	500	717	41	272	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	3.26e-18	500	717	41	273	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	4.36e-18	500	717	41	273	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	9.39e-18	501	738	29	275	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999777	CS pos: 22-23. Pr: 0.9820

TMHMM  Annotations     

There is no transmembrane helices in CGB_A9170W-t26_1-p1.