CAZyme Information: CDH60706.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH60706.1
• CAZy Family: GT71
• CAZyme Description: udp-glucosyl transferase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	CBTN010000102|CGC1	63240.28	6.6347

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000102:58969-60840(+)

Full Sequence      

MTRISILFIISSLLCLAVSSSSSSSSAPLDSGNRNDIFTELDPSSYFRSSPKNILFGVTM
GGSSHYSWVMRVLDELDRRGHNVTFATTDDSLRFSRQREHIKAVSVGPPQMNDPRLDLSE
MGFPMPFSVLETMIDILGEHYPTNYHRLVDIIEKESIDAVICDHVSYPCFDAAKKTNRPF
LVSMMVNEAPESDLPYINRNPFAMEDGNTQRMTYSHRFYDAFIYPVKALWHLGPALWRFK
QKLEALDIPVFESRWDNAVKLVNNLYGMDEPRPMGPLVELVGPIYNDHFESLTPEFTSFL
DAHKCVVYVAFGQHSQSGDNQESTRILQMLLNNYEAGVLDGFIWSATKGTPIPDHVTTAS
GTLYQLDSPEFAKIGKIVSWAPQTGILRHPSVVAFISHSGLMSLFEALYQGKRILAYPLL
TDQFANAKHIERAGVALSIPLSERLNVNRMTELLGRVVEDKDGSIQQAVNRYEALFQIHG
RRGVDRAADIVEEVLYTADSHGRLPHRHDIARNLSFLKRNNYDLYLGLFTLFALLAVLLY
QIIKLLVLPSSSKQNKLKLQ

Enzyme Prediction     

No EC number prediction in CDH60706.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	264	493	2.1e-19	0.4738219895287958

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	9.11e-44	53	493	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	1.18e-16	259	539	228	475	UDP-glucoronosyl and UDP-glucosyl transferase.
224732	YjiC	1.10e-15	54	495	4	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215304	PLN02554	1.18e-13	258	439	226	409	UDP-glycosyltransferase family protein
177813	PLN02152	9.61e-13	370	483	324	440	indole-3-acetate beta-glucosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06902.1|GT1	5.67e-308	1	560	1	547
CDS06891.1|GT1	2.80e-238	1	544	1	539
CDS11218.1|GT1	2.83e-190	40	542	30	532
CDS11217.1|GT1	5.42e-124	191	546	19	370
CDS11216.1|GT1	6.06e-124	191	543	13	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7W09_A	1.96e-11	242	431	213	404	Chain A, Glycosyltransferase [Calotropis gigantea],7W0K_A Chain A, Glycosyltransferase [Calotropis gigantea],7W0Z_A Chain A, Glycosyltransferase [Calotropis gigantea],7W10_A Chain A, Glycosyltransferase [Calotropis gigantea],7W11_A Chain A, Glycosyltransferase [Calotropis gigantea],7W1B_A Chain A, Glycosyltransferase [Calotropis gigantea],7W1H_A Chain A, Glycosyltransferase [Calotropis gigantea]
7CJX_A	1.28e-10	376	441	72	137	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2IYA_A	1.59e-10	50	498	11	423	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
6IPB_A	2.05e-10	376	441	93	158	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
6LG0_A	2.94e-09	242	437	208	390	Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_B Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_C Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_D Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_E Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis],6LG0_F Crystal structure of SbCGTa in complex with UDP [Scutellaria baicalensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P16662|UD2B7_HUMAN	6.63e-18	64	523	34	492	UDP-glucuronosyltransferase 2B7 OS=Homo sapiens OX=9606 GN=UGT2B7 PE=1 SV=2
sp|P54855|UDB15_HUMAN	4.87e-17	64	523	34	493	UDP-glucuronosyltransferase 2B15 OS=Homo sapiens OX=9606 GN=UGT2B15 PE=1 SV=3
sp|Q80X89|UD2A1_MOUSE	1.51e-16	55	523	14	491	UDP-glucuronosyltransferase 2A1 OS=Mus musculus OX=10090 GN=Ugt2a1 PE=2 SV=1
sp|O75795|UDB17_HUMAN	2.67e-16	64	544	34	511	UDP-glucuronosyltransferase 2B17 OS=Homo sapiens OX=9606 GN=UGT2B17 PE=1 SV=1
sp|P0DTE5|UD2A2_HUMAN	6.36e-16	53	523	31	499	UDP-glucuronosyltransferase 2A2 OS=Homo sapiens OX=9606 GN=UGT2A2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000548	0.999405	CS pos: 19-20. Pr: 0.9846

TMHMM  Annotations     

Start	End
526	548