CAZyme Information: CDH60041.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH60041.1
• CAZy Family: GT49
• CAZyme Description: glycoside hydrolase family 16 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		44269.32	5.8652

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000082:38424-39756(-)

Full Sequence      

MRTLDKVVKAVLLLQVIILQRASAASSSNKAQQPSSLSGQCDCGYVDEPVANSKLQDASR
VWTDMWHMDFANGQATEKMNDIFVATYNIEAKYEGTHDRTFTKDNVYMNPSGQGGLVVAV
SINGDKMHCGGFGTQRNDFLYGSFRAYIKTTPVNGTVSAMYLYNPQEEIDIEILSSVAPP
QSYFAIHPGLLEDGHASHLTHDNHHLGYDPTAEFHEYRFDWLPNLAIFYIDGVEAQRLTT
NIPKLPSRFMFNHWSDGNPNFSMGPPKETARMEIMNITAFFNHSQVDPANGFNTVVPASC
QKTQKACSVNGIADYLAQQASNTSSATKNPLTQTAQFPSSDDDNAIPSSFRDPQYGKANP
SSSSSLSSSSSSNSAGSFIVHNAYTSSIAMATVAILFFVGAMNVI

Enzyme Prediction     

No EC number prediction in CDH60041.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	113	279	3.7e-57	0.9270833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	8.36e-47	80	274	6	204	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	3.19e-19	101	264	1	160	Glycosyl hydrolases family 16.
185684	GH16_lichenase	7.62e-18	100	267	28	196	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185685	GH16_XET	1.41e-15	98	233	11	142	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.
185692	GH16_fungal_CRH1_transglycosylase	1.83e-10	139	260	45	170	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07155.1|GH16_23	4.54e-221	7	404	8	395
CDS07094.1|GH16_23	6.18e-61	41	327	31	308
UKZ96476.1|GH16_23	3.59e-34	31	302	17	318
AIA62363.1|GH16_23	6.90e-34	31	302	17	318
AIA62364.1|GH16_23	6.90e-34	31	302	17	318

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WVJ_A	1.04e-13	139	254	72	186	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
1MAC_A	4.82e-12	95	255	26	183	Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	4.98e-12	95	255	28	185	MOLECULAR AND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]
1CPN_A	1.13e-11	137	255	10	127	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]
1GBG_A	1.24e-11	100	255	33	185	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q53317|XYND_RUMFL	5.64e-14	125	254	631	759	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2
sp|P45797|GUB_PAEPO	1.55e-13	100	255	57	209	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1
sp|A3DBX3|GUB_ACET2	2.04e-12	139	254	101	215	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1
sp|Q84C00|GUB_ACETH	3.67e-12	135	254	97	215	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1
sp|Q9FI31|XTH20_ARATH	1.38e-11	83	254	11	193	Xyloglucan endotransglucosylase/hydrolase protein 20 OS=Arabidopsis thaliana OX=3702 GN=XTH20 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999734	CS pos: 24-25. Pr: 0.9762

TMHMM  Annotations     

Start	End
378	400