CAZyme Information: CDH59937.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH59937.1
• CAZy Family: GT49
• CAZyme Description: l-ascorbate oxidase-like

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	CBTN010000078|CGC1	62803.04	4.9568

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000078:57059-58796(+)

Full Sequence      

MHPIHLLLLSILILSGLTQAKLREIELTVSRQEINPDCYSQGYQRLLVNGEHPGPVIRVN
KDDELHVKVHNEGNRPTSIHFHGIFQLGTTESDGMPNVTQNDIPPGGTFEHRFRVSEQTG
TYFYHAHNDLQDESVHGAFIVYESDEAWPGKEHKLCEYGQEYDDEHILLLGEHWHQHDSE
RLDYVLGPQYAGMIAADSYLLNGRTVFEQKEGDDDDGEDDCQGYTVLPVEHGKTYRVRVI
GGLTFSSLGVAIARHTMTVIEVDGTPIKPYQVPYLEVAPGQRFSILVTADQDPSQNYWID
TKPYQLEQSDYSNGRAILKYNKEKHEMPQELPQFPPGPNEWYFPAMEPAGNSPNGFDGAP
DRTIILTPTEERMPDNTSRWYINGHEPPMWDKALLYQLKENKNLALNHTSIELSKQGSGD
GFDEATQSFPFFHGEVVDFVVHTTVMLNDGLCAGHPWHSHGQVHYAIANGPGEYIHERDK
DLRTYSTPIGKDTTFVYPVDPGSDVQPGTPCGWTKMRFFMTNPGLWSFHCHINGHMIQGM
MTVLQVAPDQIPFLN

Enzyme Prediction     

No EC number prediction in CDH59937.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	44	540	1.9e-98	0.9692737430167597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
132431	ascorbOXfungal	3.74e-80	27	543	13	528	L-ascorbate oxidase, fungal type. This model describes a family of fungal ascorbate oxidases, within a larger family of multicopper oxidases that also includes plant ascorbate oxidases (TIGR03388), plant laccases and laccase-like proteins (TIGR03389), and related proteins. The member from Acremonium sp. HI-25 is characterized.
274555	ascorbase	8.62e-73	23	551	2	528	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
215324	PLN02604	4.70e-65	19	545	21	545	oxidoreductase
177843	PLN02191	8.28e-65	20	551	21	551	L-ascorbate oxidase
274556	laccase	4.86e-56	46	546	25	519	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07261.1|AA1	0.0	1	522	1	523
CDS12532.1|AA1	2.92e-164	21	551	26	573
CDS06551.1|AA1	8.26e-126	21	551	24	645
CDS06185.1|AA1	9.66e-124	24	551	17	570
CAB4092232.1|AA1	1.29e-62	7	551	11	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AOZ_A	3.25e-59	48	551	27	528	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]
6KLG_A	4.52e-43	46	552	25	536	Crystal Structure of the Zea Mays laccase 3 [Zea mays],6KLI_A Crystal Structure of the Zea Mays laccase 3 complexed with sinapyl [Zea mays],6KLJ_A Crystal Structure of the Zea Mays laccase 3 complexed with coniferyl [Zea mays]
1HFU_A	3.28e-40	27	543	9	465	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	3.33e-40	27	543	9	465	Chain A, Laccase [Coprinopsis cinerea]
2XYB_A	1.45e-39	26	549	7	471	CRYSTAL STRUCTURE OF A FULLY FUNCTIONAL LACCASE FROM THE LIGNINOLYTIC FUNGUS PYCNOPORUS CINNABARINUS [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14133|ASO_CUCSA	4.57e-59	7	543	18	556	L-ascorbate oxidase OS=Cucumis sativus OX=3659 PE=1 SV=1
sp|P37064|ASO_CUCPM	1.67e-58	48	551	27	528	L-ascorbate oxidase OS=Cucurbita pepo var. melopepo OX=3665 PE=1 SV=1
sp|P24792|ASO_CUCMA	7.46e-57	48	551	57	558	L-ascorbate oxidase OS=Cucurbita maxima OX=3661 GN=AAO PE=1 SV=2
sp|G2QFD0|LMCO1_MYCTT	1.30e-56	27	547	35	594	Laccase-like multicopper oxidase 1 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=LMCO1 PE=1 SV=1
sp|M4DUF2|ASO_BRARP	8.51e-55	8	551	6	547	L-ascorbate oxidase OS=Brassica rapa subsp. pekinensis OX=51351 GN=AO PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000199	0.999781	CS pos: 20-21. Pr: 0.9823

TMHMM  Annotations     

There is no transmembrane helices in CDH59937.1.