CAZyme Information: CDH59863.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH59863.1
• CAZy Family: GT49
• CAZyme Description: glycoside hydrolase family 37 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800		92221.01	6.9130

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000077:34558-37237(-)

Full Sequence      

MAEQRIPSINPDDPDVHAPASTYYTTGLNARQRTRTYTKGRLQLPPRGMELPPYRRASHD
DKNKATKFLIDVEETQRLILEQEDTDGDFQITINDLGPKTLQLGTADSGGYRKIDIRGTY
MLSNLLQELALANDYGRKHIVLDEARLNENPVDRLSRMIRHHFWDGLTRRIDADTIEVIC
ADPKNRSANHNPRIYIPYSETEVYEYYQEVARQRSHLNLEVVYLPKDITPEYVKSINDRP
GLLTLAMKSHIDPFGKKTLHGVPFAVPGGRFNEMYGWDSYFVALGLLADGRRELAQGMVE
NFAYEIKHYGKILNANRSYYLTRSQPPFLTDMAHKVYERMPQSNEQKNKDWLRTVLKSAI
KEYHTVWMCEPRLDKKTMLSRYRPDGVGIPPETEASHFDHIIAPYAKKHGVSISEFDQLY
NDGKIKEPELDEYFLHDRAVRESGHDTTYRFDRVCANLATIDLNALLYKYEVDLAYIIEH
VLDGDLTDFNGEKQSASVWKKRAEERRERIDRYLWNEEKSLYFDYNTVTEKQESYETVTT
FWAMWAGCASQHQAKAMAKHSLSKFEVLGGLVSGTEESRGNISIDRPNRQWDFPFGWAPH
QIMAWEGFERYGMKDIARRLAYRWLYTITKSFVDFNGVVPEKFDVVGLSHKVEVEYGNVG
VDFKYVPREGFGWMNSSYQLGLGYLNTHARRALGTCTVPDLLFEKALARESHLRTPEEEE
ELMRRRRSSVMVARNLTRNGSVCAAVTRIGSTVEGMNHSPTRTPLGSPNRSPLNTPFRSA
EETWLAPPPLNNDEHLSPPV

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	135	682	2.3e-154	0.9898167006109979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	0.0	134	686	2	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	0.0	71	691	12	558	Neutral trehalase [Carbohydrate transport and metabolism].
215307	PLN02567	4.94e-62	263	675	142	534	alpha,alpha-trehalase
183934	treF	9.11e-57	207	694	94	544	alpha,alpha-trehalase TreF.
237326	treA	1.38e-51	263	675	149	526	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12450.1|GH37	0.0	1	800	1	800
CDS14080.1|GH37	0.0	15	751	14	748
CDS07923.1|GH37	0.0	15	749	14	738
AAX19735.1|GH37	0.0	15	706	7	700
AAX19736.1|GH37	0.0	15	704	7	700

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JTA_A	3.19e-276	50	713	75	748	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	1.08e-275	40	713	79	753	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5NIS_A	4.17e-275	71	713	6	653	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5M4A_A	3.77e-252	121	713	3	600	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	2.44e-42	263	675	115	492	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42893|TREA_SCHPO	1.02e-292	8	703	14	716	Cytosolic neutral trehalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ntp1 PE=1 SV=1
sp|O42783|TREB_NEUCR	3.01e-289	12	707	18	732	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|A0A384JRP0|TREA_BOTFB	6.66e-284	15	697	18	716	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|Q757L1|TREB_ASHGO	2.26e-282	30	704	42	725	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1
sp|O42622|TREB_MAGO7	1.39e-280	12	707	14	724	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999928	0.000107

TMHMM  Annotations     

There is no transmembrane helices in CDH59863.1.