CAZyme Information: CDH59674.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH59674.1
• CAZy Family: GT49
• CAZyme Description: polysaccharide lyase family 14 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366		40238.09	4.5380

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000073:133964-135180(-)

Full Sequence      

MHTFVVLVSTTIATLLVAAHQAGDPVITAKCATFPRARQQPNTPRAMELGMNQTWYAEMP
CTNMTEGTKTTADDLEDFIQAEWGARKSGFYAPGDVSFVTDPFGNRSSSSSDDSAVMRVY
YQKGSYTPSGSDDDVTGGCQFYMSPFEGQAFKKGLVRYDVAFSDNFDWVKGGKLPGVFGG
AHGTRGCTGGDMANGDNCFSVRLMWRENGEGEAYAYLPPSNHDLCHTEGIMCNDEFGTSL
GRGYLQFERQKWSTIEIFVQMDDLDKPNGILRVWQDGRPVIYIEGLSFRTIRSFAVSDVL
FSTFYGGGSSDYAATSDTFAYFRNVQFSVGEPETLVPPPSMASLSTTSPILLIVLCFISC
IWSLYS

Enzyme Prediction     

No EC number prediction in CDH59674.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL14	113	328	2.8e-56	0.975

CDD Domains     

CDH59674.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09498.1|PL14	4.98e-228	1	364	1	357
CDS11401.1|PL14_3	5.45e-91	38	330	23	299
CDS07190.1|PL14	2.30e-87	37	331	19	299
CDS07191.1|PL14	1.22e-68	45	330	12	282
ADV23512.1|PL14_3	7.02e-53	116	326	164	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GMT_A	3.45e-35	114	326	56	269	Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai],5GMT_B Crystal structure of the marine PL-14 alginate lyase from Aplysia kurodai [Aplysia kurodai]
6KCW_A	1.65e-07	79	325	6	235	Structure of alginate lyase Aly36B [Chitinophaga sp. MD30]
6KCV_A	5.37e-07	79	325	6	235	Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_B Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30],6KCV_C Structure of alginate lyase Aly36B mutant K143A/Y185A in complex with alginate tetrasaccharide [Chitinophaga sp. MD30]
6KZK_A	5.53e-06	79	325	6	235	Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30],6KZK_B Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30],6KZK_C Structure of alginate lyase Aly36B mutant K143A/M171A in complex with alginate trisaccharide [Chitinophaga sp. MD30]

Swiss-Prot Hits     

CDH59674.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000301	0.999698	CS pos: 22-23. Pr: 0.4160

TMHMM  Annotations     

Start	End
343	365