CAZyme Information: CDH58997.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH58997.1
• CAZy Family: GT4
• CAZyme Description: glycosyltransferase family 31 and 32 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
565		65596.18	8.0796

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000064:13466-15353(+)

Full Sequence      

MKKEFNGLWQYPKEGFLHWHRSFFPVASTRSANPTPISTMATPHGLPSFRQRALSLSSLN
VPRRFHLPIILLRLLSLIPAGIGLVQCINRAWTQPQYDETGIFENKSTPLTYCVAILWCV
LAGYWSWILTTSMMRRWLYHYEISNALVRLATLTVIHWSVYAFFSSYYGADQPMWQWMTM
CFILLVCNVFKILLASNPKYSRKAINHKSTVVRVLVLPLFIVVVFTMLAVLRQVSVLRSN
SISHAVNALSSAKMPDNVQKHPEMAEAGIRVMVFVLSAWTPKSLTKRQVFRETTMQLMPE
NNDNIAYFYRFIMGQPASDKVRETMWPQIQAEMDTHGDVLLLNCSDKYEDLSKKVFSTME
WAEQYEFDYLVKTDDDIFIRWDTITDELLELGVQTRYWQGLSYWNIPPIRDNSNKNSEFD
YPLPLFPRYTAGALYIISRDLVHLIARGPRIFVKNEDQNLGVWLFPYQVEPILDARIQQI
DVCEEDMIAKHFGDFGDPEAIGGTMYDMLDNLRNGRKMCEGFRTKFCALCYPCQGKVNHW
KHWNFDCDPVKGITLLNMPKLTLLE

Enzyme Prediction     

EC	2.4.1.149:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	286	471	2.9e-33	0.9739583333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	2.55e-22	287	472	3	193	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
403517	EOS1	1.54e-12	112	201	3	94	N-glycosylation protein. This family is not required for survival of S.cerevisiae, but its deletion leads to heightened sensitivity to oxidative stress. It appears to be involved in N-glycosylation, and resides in the endoplasmic reticulum.
178735	PLN03193	2.09e-09	310	477	181	353	beta-1,3-galactosyltransferase; Provisional
215596	PLN03133	1.66e-08	231	492	349	611	beta-1,3-galactosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11352.1|GT31	0.0	40	565	1	522
CDS13587.1|GT31|GT32	2.04e-144	44	559	4	510
CDR47493.1|GT31|GT32	3.13e-106	26	562	6	585
CAJ84709.1|GT31	5.37e-19	271	500	57	286
SVE73090.1|GT31	1.49e-17	255	491	24	257

PDB Hits     

CDH58997.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96L58|B3GT6_HUMAN	2.41e-15	262	476	48	261	Beta-1,3-galactosyltransferase 6 OS=Homo sapiens OX=9606 GN=B3GALT6 PE=1 SV=2
sp|Q864U8|B3GN5_PIG	3.82e-15	240	441	50	263	Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Sus scrofa OX=9823 GN=B3GNT5 PE=2 SV=1
sp|Q9ASW1|B3GTG_ARATH	9.83e-15	260	492	362	596	Hydroxyproline O-galactosyltransferase GALT3 OS=Arabidopsis thaliana OX=3702 GN=GALT3 PE=2 SV=1
sp|Q8BG28|B3GL2_MOUSE	5.44e-14	329	490	312	475	UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3galnt2 PE=1 SV=1
sp|Q91Z92|B3GT6_MOUSE	5.89e-14	270	476	50	257	Beta-1,3-galactosyltransferase 6 OS=Mus musculus OX=10090 GN=B3galt6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000002

TMHMM  Annotations     

Start	End
70	92
107	129
142	164
174	196
209	231