CAZyme Information: CDH58914.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH58914.1
• CAZy Family: GT39
• CAZyme Description: glycosyltransferase family 39 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759		87034.08	9.3979

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000062:180835-183755(-)

Full Sequence      

MADPQLRKRRGHEPYNENTIPSPTLADDKKKELHSLRATRFGKWNKQHAMALASVTVLSI
ITTFYKIWHPAEVVFDEVHFGKFAGFYLKRTYFFDVHPPLAKLMLAGMGWLIGYDGHFDF
GNIGDSYIENNVPYIGLRSLPATLNVLCVVLLYNIMRESGYAVLTCTLTASMYLLDNSAV
AQNRLIMLDSMLVFYMLCTAYCYIRFRKYRYQEFTRPWWFWLAATGFTMAMTISVKMVGL
FVVATIGVCVLVDLWDLMDIKRGLTMKHFMKHFNARALCLIALPTAVYLFWFYVHFAILN
QSGPGDTFMSSLFQETLKNSAIKMKSLDIHYYDVINLHHPGTEVYLHSHELRYPLRYEDG
RISSQGQQVTGVKEADENCWWRVKPTKDVPEDGKRVAVRHGDVIQLEHIATGTNLLAHDV
ASPLMSTNEEITTVPQDTRYNETLFQVILDDHNNGNIWSTHMKSVKLLHMDTKVAVWTRN
KSLPDWALKQQDVNGNKNTQDRTNFWTAHEIKGLNATEINMNKKKEIKTMPFLRKFIELQ
LRMFKHNSGLTKPHPYQSTPISWPFLIRGISYWSKSSTREQIYMTGNLFGWWLSVGAVAV
YAGVALADTLARRRGIEPIDEPLRHRFFSSGGFFLLLWLFHYLPFFAMGRSLFLHHYLPA
ATCNYLLLGAVFQFMFIDGIDSPVSALEGTTSTKYRQFQPLAMLAHPATKSYAMAAGIIT
LQLCMFIFLSPLTYGSPGLSVGQVLQRKLLGTWDLQFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	55	296	4e-67	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	55	759	30	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	4.01e-80	53	300	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	4.66e-67	534	750	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	2.37e-12	347	506	13	183	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	4.45e-09	328	385	3	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13311.1|GT39	0.0	1	759	1	759
QRW16888.1|GT39	1.08e-258	52	758	67	773
QRW02771.1|GT39	1.24e-257	50	758	65	773
QRV73816.1|GT39	1.24e-257	50	758	65	773
CCA66707.1|GT39	4.82e-252	48	758	67	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	3.09e-86	56	755	72	753	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	6.95e-86	23	754	28	728	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
1T9F_A	9.89e-07	332	432	10	103	Structural genomics of Caenorhabditis elegans: Structure of a protein with unknown function [Caenorhabditis elegans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42933|PMT4_SCHPO	2.66e-212	16	759	29	776	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	1.71e-203	55	759	59	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	2.73e-203	6	750	5	747	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|F1QF89|POMT1_DANRE	1.19e-107	52	759	18	719	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
sp|Q2LZ62|POMT1_DROPS	2.45e-104	57	759	205	903	Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rt PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000023

TMHMM  Annotations     

Start	End
49	71
91	113
134	156
185	204
217	234
238	257
277	299
588	607
627	649
653	672
712	734