CAZyme Information: CDH58358.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH58358.1
• CAZy Family: GT2|GT2
• CAZyme Description: glycoside hydrolase family 13 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1533	CBTN010000056|CGC1	174522.72	6.2731

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000056:6788-12525(-)

Full Sequence      

MTIAAATPKNTILSTGTAGQSSSTLPLVPPLYALLLADDGSPDKSNTSSKLIESPAFCKL
LHGNILSRNEHLHIQKREKYVRIPLGNQPCILRFVLRKGSLAATSSTLPRLHTTYPIQGP
FDRATFHAVEFDADGICDIPLMTPGAFEYHVTFENNRKSERVGYFVVEPRLYQSSSHKQL
PLDAIMIESMIPKWMGPLARWQPHIDLVHQTSYNMIHFAPMQQRGSSDSPYSIRDQLLFA
DDLFDNPSLLSREDRLKEVRQTIFNIQHEHGILCLSDVVWNHTSHDSVFLQDHPDAGYNL
QNSPHLVPAYELDTALLELSKSIDQHGLPQRLETRQDVDNVMSHIKNSIFPQLKLWEYDI
IDAEIAIREFSSAITQLSSSHETHKDAYKGAEDVAGQPIKRQAELFGAYAVIEGTHGTRF
HRSVDIPRAIAFVQSYAKEDEYKAVFQKLIEQYNLVWYELYDNDVKIALDNIKNRITYLR
IDDNGPKWGEISASSPLVESYFTRVNETIQVANNGWIWDADPLEDFAGPESRAYLRRQVI
CWGDCVKLRYGKSFDDNPWLWDHMRQYTEQVASLFHGIRIDNCHSTPLHVAEYLLDCARR
VRPDLYVIAELFTGSPEMDERFVSRLGIHALIREAMQAWDPHEMSRLVHRHGGKPVGSMD
QFIRWKRISKDGNEYMLIPIEHGSMPRALFMDCTHDNKTPFQMRTAEDALANSALVAFAD
CATGSVKGYDEIYPRLLDLVGEKRHYNPNVDASTTGIMRIKEQLQHLHMKMALEGYREVH
VHHEGDYVLVHRQHPRTHDGYFLVARTAFPDKHGSIDPIRLHRTRLSFMFGASLHVDTAA
AAPLDTKHLVGLPSVLADLPEPPIHSRENGFVEIELPSDFTPGSILVFQTFAQIHDTSNV
TQLVTSMPESVLESLDVLDCNVVLYRCQGEEFDATNGGGVYEVPGWGQMTYAGLEGFMAV
LRPIIRDNDLGHPFCDNLRKGHWAMDYIQNRLEVYQKNFEHHHLKPLIQWFSSRFGVIRG
LPDFLVPKYFSMAVHTAYEHVRDHALQCMAPFVHASLDPFIHQLALCSVQMLGVVPSTSL
EPIKITPTLAAGLPHFTHGCMRTWGRDVFISLRGLLMVTGQWDAARQHILAFASTLRNGL
LPNLLDAGRNPRYNARDAVWWFMQSVQDYCKLAPDGTDILSAKVSRRFPRDYEWVSHDHG
YDWDCTLAELIQEIMQQHAKGIHFREHNAGPNIDQQMKDEGFNIDIEVDWESGGVLIGGN
IWNCGTWMDKMGESEKAGNKGYPGTPRDGAPIEITGLLKSALRWLSSLCNTDVFPWKGID
RANGKTITYSEWNDLLQSNFERIYFVPREPDQDTNYAVDPSIVHRRGIYKDAYGATEPYT
EYQFRPNLCVAMVVAPELFNRQHAKQCLQLMHNVLLAPLGMRTLDPADMRYRPYYINGED
SEDFDTAKGRNYHQGPEWIWPIGYYLRAAHQFGALSSLAISRVLHAHRQEIETSTWAGLP
ELTNKDGETCWDSCFSQAWSAATILDLLYDMQQ

Enzyme Prediction     

EC	2.4.1.25:22	3.2.1.33:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	1087	1525	1.1e-201	0.9930875576036866

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273673	glyc_debranch	0.0	116	1531	48	1464	glycogen debranching enzymye. glycogen debranching enzyme possesses two different catalytic activities; oligo-1,4-->1,4-glucantransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). Site directed mutagenesis studies in S. cerevisiae indicate that the transferase and glucosidase activities are independent and located in different regions of the polypeptide chain. Proteins in this model belong to the larger alpha-amylase family. The model covers eukaryotic proteins with a seed composed of human, nematode and yeast sequences. Yeast seed sequence is well characterized. The model is quite rigorous; either query sequence yields large bit score or it fails to hit the model altogether. There doesn't appear to be any middle ground. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
405401	hDGE_amylase	0.0	178	606	1	439	Glycogen debranching enzyme, glucanotransferase domain. This is a glucanotransferase catalytic domain of the eukaryotic variant of the glycogen debranching enzyme (GDE). The eukaryotic GDEs performs two functions: 4-alpha-D-glucanotransferase, EC:2.4.1.25, and Amylo-alpha-1,6-glucosidase, EC:3.2.1.33, performed by the, respectively N- and C- terminal halves of eukaryotic GDE enzymes. The domain is a catalytic domain responsible for the glucanotransferase function. It belongs to the alpha-amylase clan and is predicted to have a structure of a 8-stranded alpha/beta barrel (TIM barrel) where strands are interrupted by long loops and additional mini-domains. In most other amylases, the catalytic domain is followed by a beta- barrel substrate binding domain, but presence of such a domain cannot be verified in the human (and other eukaryotic) GDE enzymes.
200466	AmyAc_Glg_debranch_2	0.0	163	638	2	478	Alpha amylase catalytic domain found in glycogen debranching enzymes. Debranching enzymes facilitate the breakdown of glycogen through glucosyltransferase and glucosidase activity. These activities are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct enzymes in Escherichia coli and other bacteria. Debranching enzymes perform two activities, 4-alpha-D-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). 4-alpha-D-glucanotransferase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-alpha-1,6-glucosidase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. The catalytic triad (DED), which is highly conserved in other debranching enzymes, is not present in this group. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
283786	GDE_C	2.72e-129	1068	1526	3	374	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
405402	hGDE_central	4.88e-94	756	992	1	242	Central domain of human glycogen debranching enzyme. This is a central domain of the eukaryotic variant of the glycogen debranching enzyme (GDE). The eukaryotic GDE performs two functions: 4-alpha-D-glucanotransferase, EC:2.4.1.25, and Amylo-alpha-1,6-glucosidase, EC:3.2.1.33, performed by the, respectively N- and C- terminal halves of eukaryotic GDE enzyme This central domain follows the glucanotransferase domain and precedes the glucosidase (GDE_N) domain. It is very likely that the current definition contains two or more domains, by analogy with baterial GDEs, this domain should be involved in substrate- binding either for the N-terminal glucanotransferase and/or the the C-terminal glucosidase (or both).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12463.1|GH13_25|GH133	0.0	158	1533	2	1374
CDR47418.1|GH13_25|GH133	0.0	81	1531	67	1586
CCM02450.1|GH13_25|GH133	0.0	80	1533	91	1602
EGX51015.1|GH13_25|GH133	0.0	80	1530	23	1511
CCA77894.1|GH13_25|GH133	0.0	76	1531	87	1596

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D06_A	0.0	121	1531	77	1522	Crystal Structure of the Candida Glabrata Glycogen Debranching Enzyme [[Candida] glabrata CBS 138],5D06_B Crystal Structure of the Candida Glabrata Glycogen Debranching Enzyme [[Candida] glabrata CBS 138]
5D0F_A	0.0	121	1531	77	1522	Crystal Structure of the Candida Glabrata Glycogen Debranching Enzyme (E564Q) in complex with maltopentaose [[Candida] glabrata CBS 138],5D0F_B Crystal Structure of the Candida Glabrata Glycogen Debranching Enzyme (E564Q) in complex with maltopentaose [[Candida] glabrata CBS 138]
7EIM_A	0.0	121	1531	77	1522	Chain A, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EIM_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJP_A Chain A, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJP_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJT_A Chain A, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJT_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138]
7EKU_A	0.0	121	1531	77	1522	Chain A, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EKU_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138]
7EKW_A	0.0	121	1531	77	1522	Chain A, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EKW_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A8BQB4|GDE_HORSE	0.0	111	1531	46	1533	Glycogen debranching enzyme OS=Equus caballus OX=9796 GN=AGL PE=2 SV=1
sp|P35573|GDE_HUMAN	0.0	111	1531	46	1532	Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL PE=1 SV=3
sp|P35574|GDE_RABIT	0.0	113	1531	71	1555	Glycogen debranching enzyme OS=Oryctolagus cuniculus OX=9986 GN=AGL PE=1 SV=1
sp|Q06625|GDE_YEAST	0.0	120	1531	73	1528	Glycogen debranching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDB1 PE=1 SV=1
sp|Q2PQH8|GDE_CANLF	0.0	111	1531	46	1533	Glycogen debranching enzyme OS=Canis lupus familiaris OX=9615 GN=AGL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

There is no transmembrane helices in CDH58358.1.