CAZyme Information: CDH58267.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH58267.1
• CAZy Family: GT24
• CAZyme Description: glycosyltransferase family 20

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
891	CBTN010000055|CGC1	100989.02	7.0496

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000055:43737-47361(+)

Full Sequence      

MPGGRVLCTSLFLPYTIDFELARDKRSRYLTTTTPTSTTSPTLPTEAAPASNVLREPLSH
HQHHEPPPNLIASLKQKQRHETNDNNNASSATTPLTKSSIPSDDTRAMFDFKKPEKLVQP
KSKAQREKDMKRPSPLMVQPVAPTHHHHHHHHREQSLDSATLFDEAPWTVKPCIAGNIGL
HNALVSVQGKEGDVLQDRKCMWIGTLGMSTDQLSNQTRGDIRSKMILEYDAYTVMPSDTE
FEGHYDRYCKQVLWPYFHYVVQDDLQNMMYQNDAWMAYKSLNQRFADVIVENYQEGDIIW
INDYHLMLLPGLVREKLPHAVIGFFLHIPFPSSELFRCLPTRKELLSGMLEADLVGFQTY
SFARHFLQTCSRILSLDTTPSGIQMDSHYVSIGIFPIGIDIDTLNKKRSAPEVQRSVEML
QEKYAGKKLIVARDKLDYIKGVRQKLLAFEQFLIRHPEWREKVVLIQIALSTAEKNELRA
HISDVVSRVNSKFSTISYQPIVFLHQDISFSQYLALLTAADTSLITPLRDGMNLTSHEYI
VCQENNHGPLILSEFTGTYGSFGACLRVNPWDYRQVGDAIHEALSMGEEEKAGRWKELYK
SIVTNSAQHYASSIINELIKIRNGELHRIPAQIPPLDVDHVKELFQSSKNGLLLFDYGGT
LVPHGKTAGPGDLDRISDILSKLTQRSAVYVISGRTQPIIERDLGHIPKLGLCAENGFHI
RPRGESWQRMRSDVDISWMSAVKQIFQYYTERTPGSYIETKDISIVWHYRSTTAGQDAQF
AGWQAAECQNHIADSVNKNFAVHSVTGKTNIEVMPHDINKTAIANRILQDIKPDFVLAIG
DDRMDEDMFAFLNKQKIPHVITCTVGPRSTEAKHFVPNVEGVLTTLETLLS

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	181	618	1.7e-166	0.9052631578947369

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395781	Glyco_transf_20	0.0	187	618	34	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	0.0	194	891	37	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	0.0	176	618	26	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
223457	OtsA	2.57e-174	158	618	34	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	4.39e-169	159	889	23	783	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09009.1|GT20	0.0	1	891	1	888
AMJ52388.1|GT20	1.32e-250	5	879	9	828
QUC21555.1|GT20	6.69e-217	162	891	152	905
VBB71954.1|GT20	5.23e-216	96	889	83	905
UKZ92876.1|GT20	5.49e-216	153	872	142	881

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	2.21e-123	202	621	45	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	1.98e-117	202	620	56	476	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVM_A	1.11e-112	221	621	73	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	9.70e-108	202	620	49	469	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	9.70e-108	202	620	49	469	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	4.01e-157	163	891	190	943	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	9.36e-153	182	889	82	787	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9UUI7|TPSY_SCHPO	2.83e-152	153	889	148	889	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	4.60e-150	201	841	58	690	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|P38427|TSL1_YEAST	1.18e-139	159	822	337	982	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000002

TMHMM  Annotations     

There is no transmembrane helices in CDH58267.1.