CAZyme Information: CDH58158.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH58158.1
• CAZy Family: GT22
• CAZyme Description: duf1237 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		69645.45	5.7894

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000053:84874-87046(-)

Full Sequence      

MPLHEHLSAERVTGAGGGAQVESDGDHASYYSSGSRSDSKSRLCLRRWRYINLLLSCGIL
IFFTTSFLLCLQVDDQQQPICRIWSHPNRYPVIRNPPPQPPSPSPHPMPECPDYTDFARD
FHEPGSGGPLNLPFQRPIEECRKFVSNVIDSTIETISSKMADPDLARLFTNALPNTLDTT
IQATECVRNVTHCDTPLSFVITGDIHAMWLRDSANQLLPYIDSINQDVNLKRLFLGLIHM
QAQFVHLAPYANAFNEPVSMRSDGMEKRENFNAAHTHQEGVYEYKWEIDSLASFLGFSYR
YWNMTGDDSFVRSDTWVDAVNDVLRTIQEQQEPTFDPNTGEPMTPHYTFTQNTDRPTETQ
FNEGIGNAVQRTGLVKSLFRPSDDATIFPFFIPGNAQMSVELTHISQMLSQIHGNNKAGG
GGSDKQVVSKQEQLKAIADQSGQLAKEIRDAIYKYAVVDVPGFDKVFAYEVDGYGSRLIM
DDANVPSLLSLPMLGFVDASDPVYQNTRKLVLSRANPYYFDGPRGSGIGGPHIGINYAWP
MSQIVRILTSSDDNEIKQALDIILHSTDKTGLIHESFNVYDKKDPGKDMYTRSWFAWANG
LFGQAILKIAKERPHLIMKK

Enzyme Prediction     

No EC number prediction in CDH58158.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	162	607	2.5e-154	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	162	607	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	5.15e-160	141	620	2	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
395586	Glyco_hydro_15	4.62e-04	438	534	201	291	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06540.1|GH125	0.0	108	620	1	510
CDR39949.1|GH125	5.72e-146	110	619	92	587
AQA29358.1|GH125	2.48e-143	111	617	25	511
UJO14502.1|GH125	2.48e-143	111	617	25	511
CDS06526.1|GH125	1.63e-141	396	620	264	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	5.63e-110	131	612	38	471	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.04e-108	131	612	18	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	1.82e-103	136	612	21	453	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	6.58e-82	156	615	19	430	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	2.03e-81	156	606	19	419	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.76e-140	111	619	27	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999943	0.000072

TMHMM  Annotations     

Start	End
50	72