CAZyme Information: CDH57985.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH57985.1
• CAZy Family: GT22
• CAZyme Description: gpi mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	CBTN010000051|CGC2	45555.89	9.2658

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000051:163880-165343(-)

Full Sequence      

MKTLHRIHSFAAATRVVTVGVGILSYLATGSYDSSAEIQLAPSSWAEHCLVSLLRWDALY
FNHIGEHGYIYEQEHAFFPGIPLLARMLAKTVLLPLPMREQGRVLLAGVLIANVCFVLAA
GMLYRLTSAIQPRLAFVSAIAFCLSPPAMFMSSMYMESPFALLSFTGMWLYTQNKYLLAA
LIWCFASAIRSNAIVYAGFFIYDLVLQKRSLIGMVRAILYSMITMGGFAMVQYYGYYQFC
VTGDRPWCNKTLPLLYSFVQNYYWNNGFLAYYEIKQIPNFLLAMPIILLTTKGLWHYAQS
VDGFYTLGLGQNTPADTKKLLPFLYLWGFLLAYATTCMHVQVIIRFFTSLPPLYWITAQI
WMDGFKKSASKQRQWLAQSVLSYYVLYGLVGIVLFAAFLPPA

Enzyme Prediction     

No EC number prediction in CDH57985.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	10	402	6.4e-110	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.95e-60	10	402	7	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	4.52e-25	42	402	60	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09540.1|GT76	1.79e-248	1	402	1	392
BBN03197.1|GT76	1.54e-56	2	400	8	480
AFE66668.1|GT76	4.32e-53	10	363	14	423
AFI33569.1|GT76	4.32e-53	10	363	14	423
AFH29443.1|GT76	4.32e-53	10	363	14	423

PDB Hits     

CDH57985.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NUD9|PIGV_HUMAN	2.16e-52	10	363	14	423	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q5KR61|PIGV_RAT	2.96e-52	10	363	14	423	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	1.64e-50	10	400	14	491	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q4WQ21|GPI18_ASPFU	3.44e-46	32	402	56	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	9.48e-37	32	402	38	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999514	0.000517

TMHMM  Annotations     

Start	End
7	29
105	127
134	156
179	201
214	236
251	270
277	299
325	347
380	399