CAZyme Information: CDH57880.1

Basic Information

• Species: Lichtheimia corymbifera
• Lineage: Mucoromycota; Mucoromycetes; ; Lichtheimiaceae; Lichtheimia; Lichtheimia corymbifera
• CAZyme ID: CDH57880.1
• CAZy Family: GT20
• CAZyme Description: alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		89670.74	4.9638

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LcorymbiferaJMRCFSU9682	12379	1263082	97	12282

• Gene Location: location=CBTN010000050:119583-123052(-)

Full Sequence      

MDDPRYFNSRYRGPGALETPKLIRSITIDRCSNFTSGGANGNDINLLSQLYKARTNSEEF
ISLLVYSVPDLRRIPFDEAVQQEFRPTRLGEWFGPSWSTHWFHVQLRIPNEFAGEEVHFI
WNADNEALIWSIDGMPLQGLTGGAGSDARHEYILTTNAQGGEIIQFYIEMACNGMFGAGN
GLIGPPDPNRFFNLNELDLAVPNRRAWDLLYDFQIILGMARDLSQDSLRAAQALNTANNI
VNTFLPGNDESIERCLQIASHFLNAKNGDSQHEVIALGHCHIDTGWLWPFEETIRKAARS
WSSQIDLMDRYPDYKFICSQAQQYEWVKDNYPPLWERIKEKISMGQFMPTGGTWIEMDTN
MPSGESLCRQFLLGQRFYEEHFGKRCKVFWLPDSFGYSSQLPQLMHLADMKYFFTQKLSW
NNINKFPFTTFWWIGLDGTKALTHMAPSETYNAQCTPEELIRTVRNHRDKEYSNTSLLVY
GNGDGGGGPLASMIERLRRMKNVDGLPKVEMGAPSDFYERLERDTPTLATWSGEMYFELH
RGIFTTHALCKKFNRTCELLLRDVEILATFAHIADPENFEYPKAELDQFWKMICLIQFHD
VMSGSAIEMVYDDCLQMYSKVDMLARQTRTMLMDKLLDLEDTALPEGKQALAVFNTLPWA
RSEVIEVPLDEGLPTMKQYSAFGRTGYAIVENVPPLGVRGHNFTEETEYEPVKVTTDRNN
NIVMENVFIQATFDKSGHLIGLTDKKLNRPLIRPNERGNVFRMFEDIPLFWDGELWILNV
G

Enzyme Prediction     

EC	3.2.1.24:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH38	274	537	2e-89	0.9814126394052045

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212123	GH38N_AMII_ScAms1_like	3.49e-140	274	524	2	258	N-terminal catalytic domain of yeast vacuolar alpha-mannosidases and similar proteins; glycoside hydrolase family 38 (GH38). The family is represented by Saccharomyces cerevisiae alpha-mannosidase (Ams1) and its eukaryotic homologs. Ams1 functions as a second resident vacuolar hydrolase in S. cerevisiae. It aids in recycling macromolecular components of the cell through hydrolysis of terminal, non-reducing alpha-d-mannose residues. Ams1 forms an oligomer in the cytoplasm and retains its oligomeric form during the import process. It utilizes both the Cvt (nutrient-rich conditions) and autophagic (starvation conditions) pathways for biosynthetic delivery to the vacuole. Mutants in either pathway are defective in Ams1 import. Members in this family show high sequence similarity with rat ER/cytosolic alpha-mannosidase Man2C1.
212124	GH38N_AMII_Man2C1	1.34e-134	274	524	2	252	N-terminal catalytic domain of mammalian cytosolic alpha-mannosidase Man2C1 and similar proteins; glycoside hydrolase family 38 (GH38). The subfamily corresponds to cytosolic alpha-mannosidase Man2C1 (also known as ER-mannosidase II or neutral/cytosolic mannosidase), mainly found in various vertebrates, and similar proteins. Man2C1 plays an essential role in the catabolism of cytosolic free oligomannosides derived from dolichol intermediates and the degradation of newly synthesized glycoproteins in ER or cytosol. It can catalyze the cleavage of alpha 1,2-, alpha 1,3-, and alpha 1,6-linked mannose residues. Man2C1 is a cobalt-dependent enzyme belonging to alpha-mannosidase class II. It has a neutral pH optimum and is strongly inhitibed by furanose analogs swainsonine (SW) and 1,4-dideoxy-1,4-imino-D-mannitol (DIM), moderately by deoxymannojirimycin (DMM), but not by kifunensine (KIF). DMM and KIF, both pyranose analogs, are normally known to inhibit class I alpha-mannosidase.
212101	GH38N_AMII_ER_cytosolic	1.37e-129	273	524	1	252	N-terminal catalytic domain of endoplasmic reticulum(ER)/cytosolic class II alpha-mannosidases; glycoside hydrolase family 38 (GH38). The subfamily is represented by Saccharomyces cerevisiae vacuolar alpha-mannosidase Ams1, rat ER/cytosolic alpha-mannosidase Man2C1, and similar proteins. Members in this family share high sequence similarity. None of them have any classical signal sequence or membrane spanning domains, which are typical of sorting or targeting signals. Ams1 functions as a second resident vacuolar hydrolase in S. cerevisiae. It aids in recycling macromolecular components of the cell through hydrolysis of terminal, non-reducing alpha-d-mannose residues. Ams1 utilizes both the cytoplasm to vacuole targeting (Cvt, nutrient-rich conditions) and autophagic (starvation conditions) pathways for biosynthetic delivery to the vacuole. Man2C1is involved in oligosaccharide catabolism in both the ER and cytosol. It can catalyze the cobalt-dependent cleavage of alpha 1,2-, alpha 1,3-, and alpha 1,6-linked mannose residues. Members in this family are retaining glycosyl hydrolases of family GH38 that employs a two-step mechanism involving the formation of a covalent glycosyl-enzyme complex. Two carboxylic acids positioned within the active site act in concert: one as a catalytic nucleophile and the other as a general acid/base catalyst.
223460	AMS1	1.21e-112	93	774	49	640	Alpha-mannosidase [Carbohydrate transport and metabolism].
395852	Glyco_hydro_38	1.54e-107	274	530	2	264	Glycosyl hydrolases family 38 N-terminal domain. Glycosyl hydrolases are key enzymes of carbohydrate metabolism.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06367.1|GH38	0.0	1	781	1	784
QSS62143.1|GH38	2.02e-216	12	780	6	782
AEO53968.1|GH38	2.54e-216	12	780	9	773
QSS56318.1|GH38	2.85e-216	12	780	6	782
QSS71184.1|GH38	1.13e-215	12	780	6	782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LZ1_A	8.95e-187	21	771	14	774	Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_B Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_C Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-],6LZ1_D Structure of S.pombe alpha-mannosidase Ams1 [Schizosaccharomyces pombe 972h-]
7DD9_A	2.33e-182	21	771	14	774	Chain A, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct],7DD9_C Chain C, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct],7DD9_E Chain E, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct],7DD9_G Chain G, Alpha-mannosidase,ZZ-type zinc finger-containing protein P35G2.11c,Maltose/maltodextrin-binding periplasmic protein [synthetic construct]
5JM0_A	6.06e-160	21	665	26	699	Structure of the S. cerevisiae alpha-mannosidase 1 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NTJ4|MA2C1_HUMAN	4.31e-209	27	772	13	737	Alpha-mannosidase 2C1 OS=Homo sapiens OX=9606 GN=MAN2C1 PE=1 SV=1
sp|Q91W89|MA2C1_MOUSE	1.04e-206	43	772	28	736	Alpha-mannosidase 2C1 OS=Mus musculus OX=10090 GN=Man2c1 PE=1 SV=1
sp|P21139|MA2C1_RAT	7.77e-197	61	772	42	737	Alpha-mannosidase 2C1 OS=Rattus norvegicus OX=10116 GN=Man2c1 PE=1 SV=1
sp|Q54K67|MANG_DICDI	5.69e-196	24	772	11	785	Alpha-mannosidase G OS=Dictyostelium discoideum OX=44689 GN=manG PE=1 SV=1
sp|Q9UT61|MAN1_SCHPO	1.05e-186	21	771	14	774	Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ams1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998304	0.001739

TMHMM  Annotations     

There is no transmembrane helices in CDH57880.1.